DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Ube3c

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_038964472.1 Gene:Ube3c / 362294 RGDID:1559986 Length:1083 Species:Rattus norvegicus


Alignment Length:482 Identity:145/482 - (30%)
Similarity:220/482 - (45%) Gaps:81/482 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 RTTWIDPRNGRASPM----------PNQTRRVEDDLGPLPE-----GWEERVHTDGRVFYIDHNT 603
            |..|...|.||..|:          |..:...|..|..|.|     .:||||....|:.|.|  .
  Rat   648 RHVWRFRRMGRIGPLQSTLEVGLESPPLSVSEERQLAILTELPFVVPFEERVKIFQRLIYAD--K 710

  Fly   604 RTTQWEDPRLSNPNIAGQAVPYSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIIS 668
            :..|.:.|.|...|:.                                  |||..|.||:|..:|
  Rat   711 QEVQGDGPFLDGINVT----------------------------------IRRNYIYEDAYDKLS 741

  Fly   669 SVTKTDLLKTKLWVEFEG-----ETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQIN 728
            ...:.| ||.::.|....     |.|:|.||:.||:...|.|..|||..|.|:.:   |..|...
  Rat   742 PENEPD-LKKRIRVHLLNAHGLDEAGIDGGGIFREFLNELLKSGFNPNQGFFKTT---NEGLLYP 802

  Fly   729 NGSG--LCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQK------PIDLKDMESVD 785
            |.:.  |..:....::.|:||:.|.|:|...|::.    ||....|.|      .:|:..:.|:|
  Rat   803 NPAAQMLVGDSFARHYYFLGRMLGKALYENMLVEL----PFAGFFLSKLLGTSADVDIHHLASLD 863

  Fly   786 TEYYNSLMWIK--ENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRF 848
            .|.|.:|:::|  |.|...|.|.|.:..:..|:....|||.||.:|.||..|:..||.||.::|.
  Rat   864 PEVYKNLLFLKSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYRL 928

  Fly   849 VARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQ-NIDVKDWRENTLYKGDYHMNHIII 912
            ..:::....:|..|..:::.|..:::||:.|:::|:.|.| .:.::|.:..|.|.|.|..:|.:|
  Rat   929 NKQIRPHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPVSLEDLKSFTNYSGGYSADHPVI 993

  Fly   913 QWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTP-NNFPRAHTCFN 976
            :.|||.|..|::|.:.:||:|||..||.|:.||||||.:     |.|...|:. ...|.|.||.|
  Rat   994 KIFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPA-----FCIHNGGSDLERLPTASTCMN 1053

  Fly   977 RLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            .|.||.:.....|:.||:.|||.:.||
  Rat  1054 LLKLPEFYDEALLRSKLLYAIECAAGF 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 2/5 (40%)
WW 581..613 CDD:197736 11/36 (31%)
HECTc 650..1003 CDD:238033 121/369 (33%)
HECTc 674..1003 CDD:214523 113/345 (33%)
Ube3cXP_038964472.1 IQ 47..64 CDD:197470
HECTc 725..1081 CDD:238033 123/403 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.