DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Ube3a

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001178766.1 Gene:Ube3a / 361585 RGDID:1306361 Length:868 Species:Rattus norvegicus


Alignment Length:503 Identity:147/503 - (29%)
Similarity:228/503 - (45%) Gaps:100/503 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 EDDLGPLPEG---------WEERVHTDG-RV--FYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRD 628
            |||..|:||.         .|||.:..| ||  ...:...:|.....|.:|......:.:....:
  Rat   388 EDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETEIGVKTLDCRKPLISFEEFINEPLNDVLE 452

  Fly   629 YKQKYEYFKSHIRKPTNVPNKF------------------------------------------- 650
            ..:.|.:||      ....|||                                           
  Rat   453 MDKDYTFFK------VETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQ 511

  Fly   651 -----EIRIRRTSILEDS---YRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEM 707
                 .:::||..|::|:   ..:|:.....| ||.:|:||||||.|:|.||:::|:|.|:.:|:
  Rat   512 LNPYLRLKVRRDHIIDDALVRLEMIAMENPAD-LKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEI 575

  Fly   708 FNPYYGLFEYSAMDNYT-LQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMM 771
            |||..|:|.|   |..| |...|.|....|   ..|..||.:.|:|:|:..:||..|....|:.:
  Rat   576 FNPDIGMFTY---DEATRLFWFNPSSFETE---GQFTLIGIVLGLAIYNNCILDVHFPMVVYRKL 634

  Fly   772 LQKP---IDLKDMESVDTEYYNSLMWIKENDPRI---LELTFCLDE-DVFGQKSQHELKPGGANI 829
            :.|.   .||.|...:   .|.||..:.|.:..:   :.:||.:.: |:||....::||..|..|
  Rat   635 MGKKGTFCDLGDSHPI---LYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKI 696

  Fly   830 DVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIK-IFDEHELELLMCGIQNIDVK 893
            .:||||:.|::.|..::.....|::|..:|..||..:...:.:| :|...|:|||:||.:|:|.:
  Rat   697 PITNENRKEFVSLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQ 761

  Fly   894 DWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNG---FKELYGSNGPQ 955
            ...|.|.|.|.|....::|:.||..|.||::|.:...|||.|||.|.|:.|   .|.:...|||.
  Rat   762 ALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPD 826

  Fly   956 MFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
                     ....|.:|||||.|.||.|....:||::|:|||..::||
  Rat   827 ---------TERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGF 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 11/43 (26%)
HECTc 650..1003 CDD:238033 125/415 (30%)
HECTc 674..1003 CDD:214523 119/340 (35%)
Ube3aNP_001178766.1 AZUL 27..81 CDD:406862
HECTc 516..866 CDD:238033 126/369 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.