DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Magix

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001014131.1 Gene:Magix / 317379 RGDID:1549729 Length:326 Species:Rattus norvegicus


Alignment Length:223 Identity:43/223 - (19%)
Similarity:59/223 - (26%) Gaps:93/223 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 GHDALPAG----WEERQDANGRTYYVNHTARTTQW------------DRPTVLNSHSS------- 285
            ||  |.||    :...|...|.|:     |:..:|            .||..:|...|       
  Rat   169 GH--LQAGDLVLYINGQSTRGLTH-----AQAVEWIRTGGPRLCLVLQRPQEMNGSRSKEVGGGH 226

  Fly   286 QSTDDQLASDFQRRFHISVDDTESGRSADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNN 350
            |.||             .:.|...||        .:|.....:.:.:.|||.......|.:..  
  Rat   227 QKTD-------------RIPDPRGGR--------MMESRGTISPVHHRPKTRTGPGPSPESVA-- 268

  Fly   351 NGILAQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDLRPVREAPGVPDIAI 415
                                   |..|..:..||....:..|..            :|| |.:..
  Rat   269 -----------------------TGHVVRAAEHPAEDLEDRIPG------------SPG-PWLVP 297

  Fly   416 TNPFTRRAAGNMAGGAGWQQE----RRR 439
            :.....||.|...||....||    |||
  Rat   298 SEDRLSRALGIRGGGVQLAQEMAAGRRR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809 8/44 (18%)
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
MagixNP_001014131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
PDZ_signaling 127..209 CDD:238492 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..267 13/73 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.