DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Herc4

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001012074.1 Gene:Herc4 / 309758 RGDID:1310971 Length:1057 Species:Rattus norvegicus


Alignment Length:356 Identity:107/356 - (30%)
Similarity:182/356 - (51%) Gaps:18/356 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 IRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYS 718
            :||.:|:.|:..::......| .|..|.|.|.||..:|.||:.:|:|.|:.:|:.:|.||:|.|.
  Rat   713 VRRENIVGDAMEVLRKTKNID-YKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYY 776

  Fly   719 AMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMES 783
            . |:..:..::.:    .|....|..||.|.|:|:|:..::|..|....||.:|::...|.|::.
  Rat   777 E-DSRLIWFSDKT----FEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKRKPSLDDLKE 836

  Fly   784 VDTEYYNSLMWIKENDPRILELTFCLDEDV----FGQKSQHELKPGGANIDVTNENKDEYIKLVI 844
            :..:...|:..:.:.....:|.||||:..:    ||.....||...||:..|..:|:.|::...:
  Rat   837 LMPDVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYV 901

  Fly   845 EWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNH 909
            ::.|...|.....:|..||..:....::.:|..:||:.::.|..|.|.|:..:||.|||:|...|
  Rat   902 DYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEH 966

  Fly   910 IIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNF-PRAHT 973
            ..|:.||........|.:.:.|.|:||:.|:|:.|.|.|       ...|:..|...:: |.:||
  Rat   967 PTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSL-------KLVIQSTGGGESYLPVSHT 1024

  Fly   974 CFNRLDLPPYEGYLQLKDKLIKAIEGSQGFA 1004
            |||.||||.|.....|:.|||:||:.::||:
  Rat  1025 CFNLLDLPKYTEKETLRCKLIQAIDHNEGFS 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 105/353 (30%)
HECTc 674..1003 CDD:214523 101/333 (30%)
Herc4NP_001012074.1 RCC1 1 1..51
RCC1 3..49 CDD:278826
RCC1 2 52..101
RCC1 52..99 CDD:278826
RCC1 3 102..154
RCC1 102..152 CDD:278826
RCC1 4 156..207
RCC1 157..205 CDD:278826
RCC1 5 208..259
RCC1 208..257 CDD:278826
RCC1 260..308 CDD:278826
RCC1 6 261..311
RCC1 7 313..366
RCC1 313..>343 CDD:278826
HECTc 709..1055 CDD:238033 106/354 (30%)
HECTc 735..1054 CDD:214523 100/330 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.