DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and HERC4

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:356 Identity:108/356 - (30%)
Similarity:181/356 - (50%) Gaps:18/356 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 IRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYS 718
            :||.:|:.|:..::......| .|..|.|.|.||..:|.||:.:|:|.|:.:|:.:|.||:|.|.
Human   737 VRRENIVGDAMEVLRKTKNID-YKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYY 800

  Fly   719 AMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMES 783
            . |:..:..::.:    .|....|..||.|.|:|:|:..::|..|....||.:|:|...|.|::.
Human   801 E-DSRLIWFSDKT----FEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKE 860

  Fly   784 VDTEYYNSLMWIKENDPRILELTFCLDEDV----FGQKSQHELKPGGANIDVTNENKDEYIKLVI 844
            :..:...|:..:.:.....:|.||||:..:    ||.....||...||:..|..:|:.|::...:
Human   861 LMPDVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYV 925

  Fly   845 EWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNH 909
            ::.|...|.....:|..||..:....::.:|..:||:.::.|..|.|.|:..:||.|||:|...|
Human   926 DYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEH 990

  Fly   910 IIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNF-PRAHT 973
            ..|:.||........|.:.:.|.|:||:.|:|:.|.|.|       ...|:..|....: |.:||
Human   991 PTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSL-------KLVIQSTGGGEEYLPVSHT 1048

  Fly   974 CFNRLDLPPYEGYLQLKDKLIKAIEGSQGFA 1004
            |||.||||.|.....|:.|||:||:.::||:
Human  1049 CFNLLDLPKYTEKETLRSKLIQAIDHNEGFS 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 106/353 (30%)
HECTc 674..1003 CDD:214523 102/333 (31%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 107/354 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.