DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and WWTR1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001161750.1 Gene:WWTR1 / 25937 HGNCID:24042 Length:400 Species:Homo sapiens


Alignment Length:101 Identity:28/101 - (27%)
Similarity:44/101 - (43%) Gaps:13/101 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 HTDSHNPSDISAPSTRRNSEEDNAAVPPMEQNTG--------GEEEPLPPRWSMQVAPNGRTFFI 548
            |..||     |:|::.:......||..|.:|:..        .:|.||||.|.|.....|:.:|:
Human    84 HVRSH-----SSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFL 143

  Fly   549 DHASRRTTWIDPRNGRASPMPNQTRRVEDDLGPLPE 584
            :|..:.|||.|||.....|:.:..........|:|:
Human   144 NHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 11/28 (39%)
WW 581..613 CDD:197736 2/4 (50%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
WWTR1NP_001161750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..117 9/37 (24%)
WW 125..156 CDD:197736 13/30 (43%)
Required for interaction with PALS1. /evidence=ECO:0000269|PubMed:21145499 222..400
PDZ-binding 394..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.