DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Plekha7

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_017177675.1 Gene:Plekha7 / 233765 MGIID:2445094 Length:1359 Species:Mus musculus


Alignment Length:214 Identity:59/214 - (27%)
Similarity:87/214 - (40%) Gaps:50/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 EPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLGPLPEGWEERVHTD 593
            :.||..||..|..:||.|||:...|.|||:.||.|  .|: |....:..|   ||.||||....:
Mouse     8 DTLPEHWSYGVCRDGRVFFINDQLRCTTWLHPRTG--EPV-NSGHMIRSD---LPRGWEEGFTEE 66

  Fly   594 GRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRDYKQKYEYFKSHIRKP--TNVPNKFEIRIRR 656
            |..|:||||.:||.:..|      :.||....:.:|..:.|. ..|:.||  ...|:..   :..
Mouse    67 GASFFIDHNQQTTTFRHP------VTGQFSSENSEYVLREEP-HPHMSKPERNQRPSSM---VSE 121

  Fly   657 TS---------------ILEDSYRIISSVTKTDLLKTKL--------WVEFEGETGLDYGGLARE 698
            ||               |::.|.::.|...:...::..|        |:..:..:|:..  ..|.
Mouse   122 TSTAGTTSTLEAKPGPKIVKSSSKVHSFGKRDQAIRRNLNVPVVVRGWLHKQDSSGMRL--WKRR 184

  Fly   699 WFYLLSKEMFNPYYGLFEY 717
            ||.|..       |.||.|
Mouse   185 WFVLAD-------YCLFYY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 14/28 (50%)
WW 581..613 CDD:197736 15/31 (48%)
HECTc 650..1003 CDD:238033 16/91 (18%)
HECTc 674..1003 CDD:214523 11/52 (21%)
Plekha7XP_017177675.1 WW 10..39 CDD:366073 14/28 (50%)
WW 55..84 CDD:366073 14/28 (50%)
PH_PEPP1_2_3 158..280 CDD:270068 11/48 (23%)
Smc <692..>894 CDD:224117
PHA03247 <903..1009 CDD:223021
PRK10263 <912..>1118 CDD:236669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.