DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Nedd4 and Wwc1

DIOPT Version :9

Sequence 1:	NP_648993.1	Gene:	Nedd4 / 39958	FlyBaseID:	FBgn0259174	Length:	1007	Species:	Drosophila melanogaster
Sequence 2:	NP_740749.1	Gene:	Wwc1 / 211652	MGIID:	2388637	Length:	1104	Species:	Mus musculus

Alignment Length:	144	Identity:	41/144 - (28%)
Similarity:	73/144 - (50%)	Gaps:	15/144 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   528 EEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLGPLPEGWEERVHT 592
            |.|||..|......:|:.::|||.:|.|:|||||:....|: .....:.|:   ||.||||....
Mouse     5 ELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPL-TFADCISDE---LPLGWEEAYDP 65

  Fly   593 DGRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRDYKQKYEYFKSHIRKPTNVPNK-FEIRIRR 656
            ....::|||||:|||.||||          |.:.|:.:...:.:....::..:...: ::::.:|
Mouse    66 QVGDYFIDHNTKTTQIEDPR----------VQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQR 120

  Fly   657 TSILEDSYRIISSV 670
            ..:.:..|:.:.:|
Mouse   121 LELAQQEYQQLHAV 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Nedd4	NP_648993.1	C2_NEDD4_NEDD4L	71..204	CDD:175999
		WW	248..277	CDD:278809
		WW	531..560	CDD:278809	11/28 (39%)
		WW	581..613	CDD:197736	17/31 (55%)
		HECTc	650..1003	CDD:238033	3/21 (14%)
		HECTc	674..1003	CDD:214523
Wwc1	NP_740749.1	WW	9..39	CDD:238122	12/29 (41%)
		WW	55..84	CDD:278809	15/28 (54%)
		ALDH-SF	378..>420	CDD:299846
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	429..449
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	509..547
		C2_Kibra	661..784	CDD:176062
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	822..949
		Interaction with histone H3. /evidence=ECO:0000250	836..1104
		Interaction with PRKCZ. /evidence=ECO:0000250	945..988
		ADDV motif	1102..1104
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900