DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and Hace1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_006512697.1 Gene:Hace1 / 209462 MGIID:2446110 Length:921 Species:Mus musculus


Alignment Length:392 Identity:166/392 - (42%)
Similarity:228/392 - (58%) Gaps:20/392 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 SRDYKQKYEYFKSH----------IRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTDLLKTKL 680
            ::.:|.:.|:|..|          :.:|  |.....:.:.|.||...|..|:|...... ||..:
Mouse   533 AQPFKDRCEWFYEHLHSGQPDSDMVHRP--VSENDILLVHRDSIFRSSCEIVSKANCAK-LKQGI 594

  Fly   681 WVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFI 745
            .|.|.||.|:.. |:.||||.:||.|:.||.|.||..|| |..|.|.|:.| ..|.:||:||:|.
Mouse   595 AVRFHGEEGMGQ-GVVREWFDILSNEIVNPDYALFTQSA-DGTTFQPNSNS-YVNPDHLNYFRFA 656

  Fly   746 GRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKEND--PRILELTFC 808
            |:|.|:|:.|.:|::.:|.|.|||.:|..|::.:|:.|:|.||..:|.||.:||  ...|||||.
Mouse   657 GQILGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFS 721

  Fly   809 LDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIK 873
            ::.||||...:..|||||.:|.||..||.||::||.|.|....::.|:::||.||...||.:||:
Mouse   722 VETDVFGAMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQ 786

  Fly   874 IFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTS 938
            :|||:|||||:.|:..|||.||.:||.|...|.....:|||||..|...:.|.|..|||||||:|
Mouse   787 LFDEYELELLLSGMPEIDVNDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSS 851

  Fly   939 RVPMNGFKELYGSNGPQMFTIEKWG-TPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIE-GSQ 1001
            |||..||..:.|.:|.|.|||.... |||..|.:.||.|.|.||.|.....|||:|:.|:. ||.
Mouse   852 RVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSY 916

  Fly  1002 GF 1003
            |:
Mouse   917 GY 918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 159/356 (45%)
HECTc 674..1003 CDD:214523 153/332 (46%)
Hace1XP_006512697.1 ANK repeat 66..95 CDD:293786
Ank_2 69..194 CDD:372319
ANK repeat 97..128 CDD:293786
ANK repeat 130..161 CDD:293786
ANK repeat 163..194 CDD:293786
Ank_2 168..263 CDD:372319
ANK repeat 196..233 CDD:293786
HECTc 566..915 CDD:238033 157/352 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000080
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.