DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and oxi-1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_499392.1 Gene:oxi-1 / 176515 WormBaseID:WBGene00003898 Length:1066 Species:Caenorhabditis elegans


Alignment Length:407 Identity:127/407 - (31%)
Similarity:198/407 - (48%) Gaps:36/407 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   629 YKQKYEYFKSHIRKPTNVPN-KFEIRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDY 692
            ::::.:..|:.:....|.|. :..|.::|..|:||.:..:|.:| ...||:.:.|:|..|.|||.
 Worm   661 FRRQVQDDKNRVATSLNDPQMQTWITVQRNRIIEDGFNHLSKLT-IPALKSTIRVKFVNEQGLDE 724

  Fly   693 GGL-----AREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMA 752
            .|:     .:|:..|..|::|:|...||  |......|..:..|.| :::||:.|.|:||:.|.|
 Worm   725 AGIDQDGVFKEFLELTLKKVFDPQLNLF--STTSTGVLYPSPTSSL-HDDHLALFTFVGRMLGKA 786

  Fly   753 VYHGKLLDAFFIRPFYKMML--QKPIDLKDMESVDTEYYNSLMWIK--ENDPRILELTFCLDEDV 813
            ||.|.::|..........:|  .:.....::..:|.|.|.||.::|  |.:...|.|||.:|||.
 Worm   787 VYEGIVVDVQLAPVLLAAVLGSHRLCAFDELSQLDPELYRSLTFVKRYEGEMADLSLTFSVDEDF 851

  Fly   814 FGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEH 878
            .|:.|..:|.|.|..|.||||||.:|:..:...|...|.:||..:|:.|..||:....:.:|..:
 Worm   852 MGKISTVDLVPSGRTISVTNENKIDYVHRMAHHRVFRRTQEQCKAFVTGMQSILQPTWLSLFAPN 916

  Fly   879 ELELLMCGI-QNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLS-FSNEMRSRLLQFVTGTSRVP 941
            :|:.|:.|: .:||:.|.:.|..|.|.:|.||.:|:|.|..:.: |::|.|...|:|||..||.|
 Worm   917 DLQCLISGVNSDIDLADLKRNVQYFGGFHGNHRLIKWLWDILENKFTSEERKLFLKFVTSCSRPP 981

  Fly   942 MNGFKEL--------------------YGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGY 986
            :.||..|                    .||.......:.|.......|.|.||||.|.||.|...
 Worm   982 VLGFSYLEPPFSIRCVEVSDDQDQGDTLGSVVRGFLALRKGTAATRLPTASTCFNLLKLPNYNKK 1046

  Fly   987 LQLKDKLIKAIEGSQGF 1003
            ..|.:||..||....||
 Worm  1047 SLLLEKLRYAIHAGTGF 1063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 122/383 (32%)
HECTc 674..1003 CDD:214523 115/359 (32%)
oxi-1NP_499392.1 HECTc 684..1064 CDD:238033 124/384 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.