DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and etc-1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_495842.1 Gene:etc-1 / 174388 WormBaseID:WBGene00008429 Length:1001 Species:Caenorhabditis elegans


Alignment Length:475 Identity:120/475 - (25%)
Similarity:217/475 - (45%) Gaps:58/475 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   568 MPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLSNPNIAGQA---------- 622
            |||...::|..:.      .|.|.....::.:|.::.... ||...:.|.:..:|          
 Worm   543 MPNGRLQIERTMD------TEFVERLAAIYEMDSDSENDD-EDEDNNLPAVLRRAICVMKHIPFI 600

  Fly   623 VPYSRDYK--------QKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISSVTKTD----- 674
            ||:....|        .|.:::.|......|.|:   :.:||..:..|::...:...:.|     
 Worm   601 VPFMDRVKLFTRLLNQDKEKHYTSTFGMGFNGPS---VTVRRDQVYMDAFETFAPKMQGDKVNDL 662

  Fly   675 --LLKTKLWVEFEG--ETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQIN-NGSGLC 734
              :::.|: |.:.|  |:|:|.||:.||:...|.|..||...|.|.::  ::..|..| ....|.
 Worm   663 KSMVRVKM-VNWAGMNESGIDGGGIFREFLSELLKTAFNVERGFFTFT--ESKLLYPNPTAPFLL 724

  Fly   735 NEEHLSYFKFIGRIAGMAVYHGKLLDA----FFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWI 795
            ..:.|::|:||||:.|..:|..:|.:.    |||...::....|.:||:.|:|.|...:..|..:
 Worm   725 GVDCLAHFQFIGRMIGKLIYERQLQEVRFAEFFIAQIFETDKNKDVDLQHMKSFDPIIFKHLKAL 789

  Fly   796 KENDPR---ILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMS 857
            ::.:.|   .|:|.|.:.....|......|||.|:...||.||..||::|.:.:....|:...:.
 Worm   790 QKMNNRELDELQLDFSVVTSDMGLVRNVNLKPNGSKFRVTVENVHEYVRLYVNYHLKQRIASMVD 854

  Fly   858 SFLDGFGSIIPLNLIKIFDEHELELLMCGIQNI----DVKDWRENTLYKGDYHMNHIIIQWFWRA 918
            :...|...||.:..:::|..|||::::.|.:.:    :::.:.|.....|...:|:  .:.||..
 Worm   855 AVRKGISEIISIEWMRMFAPHELQIMIAGYEEVFTAKELRKFCELRFAAGTQDINY--EEMFWDV 917

  Fly   919 VLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPY 983
            :...||:.:..||:||||.||.|::|||.:.    |:|..:....:.:..|.:.||.|.|.:|.|
 Worm   918 IDKLSNDDKKALLKFVTGCSRAPVDGFKSIQ----PRMGVLVIPSSDDELPTSATCMNMLRIPKY 978

  Fly   984 EGYLQLKDKLIKAIEGSQGF 1003
            ....:|::||..||....||
 Worm   979 SNRTKLEEKLRYAINSGAGF 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736 5/31 (16%)
HECTc 650..1003 CDD:238033 100/373 (27%)
HECTc 674..1003 CDD:214523 97/349 (28%)
etc-1NP_495842.1 HECTc 661..998 CDD:214523 96/345 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.