DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and herc-1

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_490834.1 Gene:herc-1 / 171700 WormBaseID:WBGene00021685 Length:1019 Species:Caenorhabditis elegans


Alignment Length:361 Identity:107/361 - (29%)
Similarity:192/361 - (53%) Gaps:20/361 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 EIRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLF 715
            |:.:||..|:.|:...::.::::||.| .|.|...||...|.||:.:|:|.|:.:::....||:|
 Worm   668 ELTVRREFIVSDTMNQMAGLSESDLQK-PLKVNIAGEDADDAGGVRKEFFILVMRKILQSDYGMF 731

  Fly   716 EYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKD 780
            ......:........|..|:.|.   |..:||:.|:::|:..::...|....||.:|..|.||:|
 Worm   732 SEDEESHLVWFSGLPSEFCDREQ---FHQLGRLVGLSIYNHSIVPFPFPLALYKYLLDTPPDLED 793

  Fly   781 ---MESVDTEYYNSLMWIKENDPR-ILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIK 841
               :...:.:....|:..:|:|.. :..|.||:..::.|:....||..||....|||.|:|||::
 Worm   794 LCELSPSEGKGLKMLLSYEEDDVEDVFGLNFCISFNILGETHTTELLSGGTEKPVTNANRDEYVR 858

  Fly   842 LVIEWR----FVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYK 902
            |.:..|    :...:.:|...|..||...:....::.|...||:.::.|.:|.|..::|:..:|:
 Worm   859 LYVHHRLELGYNGEIAQQALLFRKGFSESLHSRTLRFFQPCELKEMIVGNENYDWNEFRDILMYR 923

  Fly   903 GDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNN 967
            |:|..:|..||.||:|..:.:::.|.:.|||:||::|:|::|::||:.:..|        ..|.:
 Worm   924 GEYSSSHPTIQAFWKAFFALTDDERRKFLQFLTGSTRIPVSGWEELHAAIQP--------SAPES 980

  Fly   968 FPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            .|.||||||.||||.....::|..:|..:||.::||
 Worm   981 LPVAHTCFNLLDLPNIADDVELLRRLRISIEHTEGF 1016

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 105/359 (29%)
HECTc 674..1003 CDD:214523 100/336 (30%)
herc-1NP_490834.1 ATS1 2..359 CDD:227511
HECTc 667..1016 CDD:238033 105/359 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.