DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and PLEKHA7

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_024304124.1 Gene:PLEKHA7 / 144100 HGNCID:27049 Length:1365 Species:Homo sapiens


Alignment Length:325 Identity:72/325 - (22%)
Similarity:120/325 - (36%) Gaps:100/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 EPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLGPLPEGWEERVHTD 593
            :.||..||..|..:||.|||:...|.|||:.||.|  .|: |....:..|   ||.||||....:
Human     9 DTLPEHWSYGVCRDGRVFFINDQLRCTTWLHPRTG--EPV-NSGHMIRSD---LPRGWEEGFTEE 67

  Fly   594 GRVFYIDHNTRTTQWEDPRLSNPNIAGQAVPYSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTS 658
            |..::||||.:||.:..|      :.||..|.:.::..:.|        |....:|.:...|.:|
Human    68 GASYFIDHNQQTTAFRHP------VTGQFSPENSEFILQEE--------PNPHMSKQDRNQRPSS 118

  Fly   659 ILEDSY--------------RIISSVTKTDL---------------LKTKLWVEFEGETGLDYGG 694
            ::.::.              :||.|.:|...               :..:.|:..:..:|:..  
Human   119 MVSETSTAGTASTLEAKPGPKIIKSSSKVHSFGKRDQAIRRNPNVPVVVRGWLHKQDSSGMRL-- 181

  Fly   695 LAREWFYLLSKEMFNPYYGLFEYS-----------AMDNYTLQINNGSGLCNEEHLS-YFKFIGR 747
            ..|.||.|..       |.||.|.           .:.:|.:     |.:..|:.:| .:.|...
Human   182 WKRRWFVLAD-------YCLFYYKDSREEAVLGSIPLPSYVI-----SPVAPEDRISRKYSFKAV 234

  Fly   748 IAGM--AVYH----GKLLDAFFIRPFY-------------------KMMLQKPIDLKDMESVDTE 787
            ..||  .:|:    |...:...:|.:|                   ..:|.:....:|||.|:.:
Human   235 HTGMRALIYNSSTAGSQAEQSGMRTYYFSADTQEDMNAWVRAMNQAAQVLSRSSLKRDMEKVERQ 299

  Fly   788  787
            Human   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 14/28 (50%)
WW 581..613 CDD:197736 14/31 (45%)
HECTc 650..1003 CDD:238033 32/204 (16%)
HECTc 674..1003 CDD:214523 26/166 (16%)
PLEKHA7XP_024304124.1 WW 11..40 CDD:306827 14/28 (50%)
WW 56..85 CDD:306827 13/28 (46%)
PH_PEPP1_2_3 159..281 CDD:270068 21/135 (16%)
NESP55 <299..460 CDD:115071 0/1 (0%)
DUF1640 779..905 CDD:311647
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.