DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and herc5.4

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_005160166.1 Gene:herc5.4 / 100148091 ZFINID:ZDB-GENE-090311-7 Length:995 Species:Danio rerio


Alignment Length:405 Identity:118/405 - (29%)
Similarity:184/405 - (45%) Gaps:59/405 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 PYSRDY--KQKY------EYFKSHIRKPTNVP-----NKFE--IRIRRTSILEDSYRIISSVTKT 673
            |::.|:  ||:.      |.|:       |||     |.|.  :.|.|.|:|.|:.:.:..  .|
Zfish   622 PFASDFITKQRMFNLLQEECFR-------NVPNLAMGNSFSNLLHINRESVLTDTLQYLRQ--NT 677

  Fly   674 DLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGL-CNEE 737
            ......|.|.|.||.|:|..||:.|:|.|:||          .:...|...|:::..|.: .|..
Zfish   678 HSFMHPLQVAFIGEDGIDMRGLSAEFFSLISK----------SFIEWDKKILEVHESSLVWFNPH 732

  Fly   738 HL---SYFKFIGRIAGMAVYHGKLLDAFF-IRPFYKMMLQKPI--DLKDMESVDTEYYNSLMWIK 796
            |.   ..|.::|.|.|||:|:...::..| :..|.|::.|||.  ||:::..|:.....:|  ::
Zfish   733 HTRGNKNFYYLGVICGMALYNRHHINIDFPLALFKKLLQQKPSLDDLEELSPVEARSLKNL--LE 795

  Fly   797 ENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLD 861
            |::..::.|.. ||....||    ||.|.|:.|.|...|:.:|:.|.::..|...||.|...|..
Zfish   796 EDEEEVVNLQH-LDFTCKGQ----ELVPNGSQIQVNKVNRQKYVDLYVDLEFNKSVKTQFEQFTR 855

  Fly   862 GFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEM 926
            ||....||:...:|...||:.|:.|....:.|:.:::..|:| ...:..:|:.||......|.|.
Zfish   856 GFSKGCPLDAWTMFHPEELQELLHGSPQYNWKELQQSASYEG-CSASDELIKNFWTVFFELSEEN 919

  Fly   927 RSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTP---NNFPRAHTCFNRLDLPPYEGYLQ 988
            :.:.|.|:.||.|||..|..:       :...|.:...|   ::.|.|.|||.||.||.|.....
Zfish   920 KKKFLMFLYGTERVPAGGLSK-------RALKISQTDCPDPDDHLPEAQTCFERLVLPKYSDINT 977

  Fly   989 LKDKLIKAIEGSQGF 1003
            |.||||.||.....|
Zfish   978 LHDKLIHAINSCAVF 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 107/364 (29%)
HECTc 674..1003 CDD:214523 100/338 (30%)
herc5.4XP_005160166.1 RCC1_2 117..146 CDD:290274
RCC1 133..183 CDD:278826
RCC1 186..235 CDD:278826
RCC1 239..286 CDD:278826
RCC1 294..343 CDD:278826
HECTc 658..993 CDD:294058 107/362 (30%)
HECTc 682..992 CDD:214523 100/334 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.