DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and herc5.3

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_021330683.1 Gene:herc5.3 / 100073325 ZFINID:ZDB-GENE-070615-14 Length:1002 Species:Danio rerio


Alignment Length:363 Identity:101/363 - (27%)
Similarity:173/363 - (47%) Gaps:39/363 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 IRIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFE 716
            :.|.|.|:|.|:.:.:...|.:  ....|.|.|.||..:|...::.|:|.|:||          .
Zfish   665 LHINRESVLTDTLQYLRPFTYS--FMHPLQVAFIGEDEIDEKVISAEFFSLISK----------S 717

  Fly   717 YSAMDNYTLQINNGSGLC-----NEEHLSYFKFIGRIAGMAVYHGKLLDAFF-IRPFYKMMLQKP 775
            :...|...|:::..|.:.     .::|..:: ::|.|.|||:|:...::..| :..|.|::.|||
Zfish   718 FIEWDKKILEVHESSLVWFNPHHTQDHRDFY-YLGVICGMALYNRHHINIDFPLALFKKLLQQKP 781

  Fly   776 I--DLKDMESVDTEYYNSLMWIKENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDE 838
            .  ||:::..|:.....:|  ::|::..:::|.. ||....||    ||.|.|:.|.|...|:.:
Zfish   782 SLDDLEELSPVEARSLKNL--LEEDEEEVVDLQH-LDFTCKGQ----ELVPNGSQIQVNKVNRQK 839

  Fly   839 YIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKG 903
            |:.|.:::.|...||.|...|.:||....||:...:|...||:.|:.|....:..:.:::..|:|
Zfish   840 YVDLYVDFVFNKSVKTQFEQFTEGFSEGCPLDAWTMFHPEELQELLHGSPQYNWNELQQSASYEG 904

  Fly   904 DYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTP--- 965
             ...:..:|:.||......|.|.:.:.|.|:.||.|||..||.:       :...|.:...|   
Zfish   905 -CSASDELIKNFWTVFFELSEENKKKFLMFLYGTERVPAGGFSK-------RALKISQTDCPDPD 961

  Fly   966 NNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGF 1003
            ::.|.|.|||.||.||.|.....|:||||.|:.....|
Zfish   962 DHLPEAQTCFERLVLPKYSDINTLRDKLIHAVNSCAVF 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033 100/361 (28%)
HECTc 674..1003 CDD:214523 94/339 (28%)
herc5.3XP_021330683.1 RCC1 <74..349 CDD:332518
HECTc 665..1000 CDD:331829 101/363 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.