DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nedd4 and magi2b

DIOPT Version :9

Sequence 1:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_021326360.1 Gene:magi2b / 100001810 ZFINID:ZDB-GENE-141211-6 Length:1171 Species:Danio rerio


Alignment Length:242 Identity:55/242 - (22%)
Similarity:98/242 - (40%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 QQQQNRILLDVDHRQQEPQHRGQRHQQQHRP---------SNEDTDHTDSHNPSDISAP------ 504
            ::::|:.:.:::....||    ...:::..|         :.|.::|.|....:....|      
Zfish    51 KRKRNKSVSNMEKDSIEP----PEEEEEESPIINGNGIAITPESSEHEDKSTDASGDVPVQPCPP 111

  Fly   505 ------STRRNSEEDNAAVPPMEQNTGGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNG 563
                  :|....||.:|...|.:.....:...||..|.|.....|..:||||.::.|:|:|||..
Zfish   112 ETPTLTATDVPEEEGDAPKSPQDLQENDDMGSLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLA 176

  Fly   564 RASPMPNQTRRVEDDLGPLPEGWEERVHTDGRV---FYIDHNTRTTQWEDP-------------- 611
            :.:..|.:..  ||:   ||.|||:   .|..:   :|:||..|.||:|:|              
Zfish   177 KKAKPPEECE--EDE---LPYGWEK---IDDPIYGSYYVDHINRRTQFENPVLEAKRRIQQQQQM 233

  Fly   612 ------RLSNPNIAGQAVPYSRDYKQKYEYFKSHIRKPTNVPNKFEI 652
                  .|..|.|..:..|::||..|....|.:.:.:.:|:...|.|
Zfish   234 QSQGLSALPLPTIYREKPPFTRDATQLKGTFLTTVLQKSNMGFGFTI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 11/28 (39%)
WW 581..613 CDD:197736 14/54 (26%)
HECTc 650..1003 CDD:238033 2/3 (67%)
HECTc 674..1003 CDD:214523
magi2bXP_021326360.1 NK <1..>29 CDD:327404
MAGI_u1 35..96 CDD:318800 6/48 (13%)
WW 145..175 CDD:238122 12/29 (41%)
WW 190..219 CDD:306827 13/31 (42%)
PDZ 266..349 CDD:214570 3/15 (20%)
PDZ 451..531 CDD:214570
PDZ 622..708 CDD:214570
PDZ_signaling 743..832 CDD:238492
PDZ_signaling 1034..1114 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.