DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edc3 and nnr

DIOPT Version :9

Sequence 1:NP_648992.1 Gene:Edc3 / 39957 FlyBaseID:FBgn0036735 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_418588.1 Gene:nnr / 948685 ECOCYCID:EG11758 Length:515 Species:Escherichia coli


Alignment Length:165 Identity:42/165 - (25%)
Similarity:61/165 - (36%) Gaps:43/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AVSIACDEVLGVFQGLIKQISAEEITIVRAFRNGVPLRKQNAEVVLKCTDIRSIDLIEPAKQDLD 76
            :|.:..|.:||.  || :|...|.|:.:....|..|     |.:|  ..||.|..|.|..     
E. coli   129 SVDLIVDALLGT--GL-RQAPRESISQLIDHANSHP-----APIV--AVDIPSGLLAETG----- 178

  Fly    77 GHTAPPPVVN----------KPTPVKLPHFSNILGKQQQLQLQQQQQQLQL------QQQQKQQF 125
              ..|..|:|          ||        ..:.||.:.:..|.....|.|      |:.:.|:|
E. coli   179 --ATPGAVINADHTITFIALKP--------GLLTGKARDVTGQLHFDSLGLDSWLAGQETKIQRF 233

  Fly   126 QEQEREQDL-PSTPRSRANDNGR-VAAGGASSSSG 158
            ..::....| |..|.|...|:|| |..||...::|
E. coli   234 SAEQLSHWLKPRRPTSHKGDHGRLVIIGGDHGTAG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edc3NP_648992.1 LSm16_N 5..69 CDD:212484 17/56 (30%)
FDF 343..>397 CDD:286601
YjeF_N 453..583 CDD:294225
nnrNP_418588.1 PRK10565 1..508 CDD:182554 42/165 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0062
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.