DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edc3 and PPOX

DIOPT Version :9

Sequence 1:NP_648992.1 Gene:Edc3 / 39957 FlyBaseID:FBgn0036735 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_568717.2 Gene:PPOX / 835061 AraportID:AT5G49970 Length:530 Species:Arabidopsis thaliana


Alignment Length:220 Identity:44/220 - (20%)
Similarity:84/220 - (38%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LDGHTAPPPVVNKPTPVKLPHFSNI-----LGKQQQLQLQQQQQQLQLQQQQKQQFQEQEREQDL 134
            |.|...||.|..| ..::||.:...     :||..::.:...:     ......:..|::.|.| 
plant   280 LGGRFVPPSVAEK-YKLELPSYPGTSMCVRIGKPPKVDISAMR-----VNYVSPELLEEQVETD- 337

  Fly   135 PSTPRSRANDNGRVAAG--GASSSSGPRGNFNSALSDKMHQLKLIETNGSNGTLRTPQTSRASSA 197
             .|.:.|...:..||||  ..::.:....|.:...|.:|..||..:.||.  ...|...|:..| 
plant   338 -PTVQFRKWFDEAVAAGLRETNAMALSTANKDKKPSSRMVLLKGFDENGF--VWFTNYESKKGS- 398

  Fly   198 QQQPQISTTPNSVAAFFGNMIPPKVEVK--LGSYVSNTRESYCSSSGDSGEATGLSLGS--SKPI 258
                .:|..|::...|:..::..:|.::  :.....:..|:|..|     ...|..:|:  ||..
plant   399 ----DLSENPSAALLFYWEILNRQVRIEGPVERIPESESENYFHS-----RPRGSQIGAIVSKQS 454

  Fly   259 DIVSNGDGFYKQTAASSYGNTNGNV 283
            .:|......|.:....:...::|:|
plant   455 SVVPGRHVLYDEYEELTKQYSDGSV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edc3NP_648992.1 LSm16_N 5..69 CDD:212484
FDF 343..>397 CDD:286601
YjeF_N 453..583 CDD:294225
PPOXNP_568717.2 PLN02918 4..530 CDD:215496 44/220 (20%)
YjeF_N 65..309 CDD:294225 8/29 (28%)
Pyridox_oxidase 347..432 CDD:279568 18/91 (20%)
PNPOx_C 486..530 CDD:287549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0062
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.