DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edc3 and Yjefn3

DIOPT Version :9

Sequence 1:NP_648992.1 Gene:Edc3 / 39957 FlyBaseID:FBgn0036735 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001340859.1 Gene:Yjefn3 / 234365 MGIID:2681845 Length:251 Species:Mus musculus


Alignment Length:260 Identity:54/260 - (20%)
Similarity:95/260 - (36%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 ISADKAGLSLQRQIDILARGASDLAITLLGGARRLT-------PANNHQWPKIAIICDGGKNMRT 493
            :||.:|. :|:|::....|......:.|.|.|..:.       |:.:.:...:.::|...:|   
Mouse    21 LSASEAA-ALERELLEEYRFGRQQLVELCGHASAVAVTKAFPLPSLSRKQRTVLVVCGPEQN--- 81

  Fly   494 INIGAATGRQLASHGLTVLLY-------VEQAKLLEQNSSS-------PEISLFKATDNVIVHS- 543
                .|.|...|.| |.|..|       ...|..|.::.::       |.:|...|...:|..: 
Mouse    82 ----GAVGLACARH-LRVFEYQPSIFCPARSADALHRDLTTQCEKMDIPFLSFLPAEVRLIDDAY 141

  Fly   544 ---VDALPTPDLVILSTNTANLSDAIRKWLSVNRASVLAIDPPPCGINEVAIKYSILPILPLNGI 605
               |||:..|.:        .|::|     ..:.|..||           .:|...:|::.|:..
Mouse   142 GLVVDAVLGPGV--------RLAEA-----GGHCARALA-----------TLKRLSIPLVSLDVP 182

  Fly   606 S--TATTSSSSSAAATPTPIASTSAAASATKSAASTNNCGKL-YLCNLGIPDKFYRDCGI---KY 664
            |  .|.....:..|..|..:.|    .:|.||.|...: |:| ::....:||...|..|:   ||
Mouse   183 SGWDAEAGGDAKDAVQPDVLVS----LAAPKSCAGRFS-GRLHFVAGRFVPDDVRRKFGLHLPKY 242

  Fly   665  664
            Mouse   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edc3NP_648992.1 LSm16_N 5..69 CDD:212484
FDF 343..>397 CDD:286601
YjeF_N 453..583 CDD:294225 29/154 (19%)
Yjefn3NP_001340859.1 PNPOx_C 15..>248 CDD:330506 54/260 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0062
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.