DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edc3 and AgaP_AGAP003324

DIOPT Version :9

Sequence 1:NP_648992.1 Gene:Edc3 / 39957 FlyBaseID:FBgn0036735 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_319557.4 Gene:AgaP_AGAP003324 / 1279744 VectorBaseID:AGAP003324 Length:229 Species:Anopheles gambiae


Alignment Length:36 Identity:11/36 - (30%)
Similarity:16/36 - (44%) Gaps:8/36 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 DDIESTTQKPDVVRHIVNNHHH--------KPEQKY 388
            |.:.|.|......:|:||..|:        |.|:||
Mosquito   177 DCLISLTAPKLCAKHLVNAKHYLGGRFVPGKLEEKY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edc3NP_648992.1 LSm16_N 5..69 CDD:212484
FDF 343..>397 CDD:286601 11/36 (31%)
YjeF_N 453..583 CDD:294225
AgaP_AGAP003324XP_319557.4 YjeF_N 1..228 CDD:294225 11/36 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0062
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.