DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7564 and Luc7l3

DIOPT Version :9

Sequence 1:NP_001261989.1 Gene:CG7564 / 39956 FlyBaseID:FBgn0036734 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_080589.1 Gene:Luc7l3 / 67684 MGIID:1914934 Length:491 Species:Mus musculus


Alignment Length:425 Identity:130/425 - (30%)
Similarity:203/425 - (47%) Gaps:78/425 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MLDQLMGTTRN--GDERQ--LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYE 77
            :||:|||..||  .||::  :::....|||.:|...||.::..:||.|||.|.|:||...|..||
Mouse     7 LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYE 71

  Fly    78 SAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEVA----EKANAVHGLAEEI 138
            .:::.....|:.:.:.:||:.:|:.:||......||..:|.:.::..|    :....:..|.::|
Mouse    72 KSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKI 136

  Fly   139 GKKLAKAEALGEAGEVEDSMELMKEIEELRAKKIKAEHEYRTSMPAS----TYQQQKLRVCEVCS 199
            ...|.:.|.||..|:||::..:||.:|:|     |.|.|...|..::    ..|::::.|||||.
Mouse   137 DVLLQQIEELGSEGKVEEAQGMMKLVEQL-----KEERELLRSTTSTIESFAAQEKQMEVCEVCG 196

  Fly   200 AYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTAAPRKAELKRTGKMTDREDEGRGRNRYF 264
            |:|.:.|...|:.||..||.|:|:..|:..:.||       |.:|::..:..||           
Mouse   197 AFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL-------KEKLRKRTEEPDR----------- 243

  Fly   265 VGGRELDRRSRVHRSRSRERQRNRDGDRERPNNGRGPEEKGSERPKEAADGPERAERAPDR---G 326
                  |.|.:..:....||::.|:.:||.....|..||:  ||.||.|...||.:|:..|   .
Mouse   244 ------DERLKKEKQEREEREKEREREREERERKRRREEE--EREKERARDRERRKRSRSRSRHS 300

  Fly   327 GRRDDRD-NHGRDH-RERERDGRRDRDRHGRNDRGRFGDRGGGGGGGGHHRDDRR-RSRSRER-- 386
            .|..||. :..||| |.|.||.||.|.|..|..|             .|.|.:|: |||||:|  
Mouse   301 SRTSDRRCSRSRDHKRSRSRDRRRSRSRDRRRSR-------------SHDRSERKHRSRSRDRRR 352

  Fly   387 -SPRERRNFNHFRDGGGGGNGQRKRSYSRERNYRR 420
             ..|:|:::.|             ||.||:|...|
Mouse   353 SKSRDRKSYKH-------------RSKSRDREQDR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7564NP_001261989.1 LUC7 11..248 CDD:227527 75/242 (31%)
LUC7 12..246 CDD:281222 75/240 (31%)
Luc7l3NP_080589.1 LUC7 4..233 CDD:367386 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2181
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.