DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7564 and luc7l3

DIOPT Version :9

Sequence 1:NP_001261989.1 Gene:CG7564 / 39956 FlyBaseID:FBgn0036734 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001016304.1 Gene:luc7l3 / 549058 XenbaseID:XB-GENE-5815904 Length:434 Species:Xenopus tropicalis


Alignment Length:427 Identity:125/427 - (29%)
Similarity:204/427 - (47%) Gaps:79/427 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MLDQLMGTTRN--GDERQ--LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYE 77
            :||:|||..||  .||::  :.:....|||.:|.:.||.::..:||.|||.|.|:||...|..||
 Frog     7 LLDELMGRDRNLAPDEKRTNVHWDRESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYE 71

  Fly    78 SAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTA----EVAEKANAVHGLAEEI 138
            .:::.....|:.:.:.:||:.:|:.:||......||..:|.:..:    ...:....:..|.::|
 Frog    72 KSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKIQVLTDKI 136

  Fly   139 GKKLAKAEALGEAGEVEDSMELMKEIEELRAKKIKAEHEYRTSMPAS----TYQQQKLRVCEVCS 199
            ...|.:.|.||..|:||::..:||.:|:|     |.|.|...|..::    ..|::::.|||||.
 Frog   137 DGLLQEIEELGSEGKVEEAQGMMKLVEQL-----KEERELLKSTTSTIESFAAQEKQMEVCEVCG 196

  Fly   200 AYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTAAPRKAELKRTGKMTDREDEGRGRNRYF 264
            |:|.:.|...|:.||..||.|:|:..|:..:.||       |.:|::.....|||          
 Frog   197 AFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL-------KEKLRKKSSDPDRE---------- 244

  Fly   265 VGGRELDRRSRVHRSRSRERQRNRDGDRERPNNGRGPEEKGSERPKEAADGPERAERAPDRGGRR 329
                |..:|.|..:.|.:|:::.::.:||.....|..||:..|:.:..    ||.:|...|.|.|
 Frog   245 ----ERSKRERDDKEREKEKEKEKEKEREEREKKRRREEEAKEKERNR----EREKRKRSRSGSR 301

  Fly   330 ------DDRDNHGRDH-RERERDGRRDRDRHGRNDRGRFGDRGGGGGGGGHHRDDRR-RSRSRER 386
                  |.|.:..||| |.|.||.:|.|.|..:..:             .|:|.:|: ||||||:
 Frog   302 NSSRTSDRRGSRSRDHKRSRSRDRKRSRSRERQRSQ-------------SHNRTERKHRSRSREK 353

  Fly   387 ---SPRERRNFNHFRDGGGGGNGQRKRSYSRERNYRR 420
               ..|||:::.|             :|.||||:..|
 Frog   354 RRSKSRERKSYKH-------------KSRSRERDRDR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7564NP_001261989.1 LUC7 11..248 CDD:227527 74/242 (31%)
LUC7 12..246 CDD:281222 74/240 (31%)
luc7l3NP_001016304.1 LUC7 4..246 CDD:281222 77/264 (29%)
LUC7 4..238 CDD:227527 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.