DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7564 and Luc7l3

DIOPT Version :9

Sequence 1:NP_001261989.1 Gene:CG7564 / 39956 FlyBaseID:FBgn0036734 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001101761.1 Gene:Luc7l3 / 360602 RGDID:1307981 Length:491 Species:Rattus norvegicus


Alignment Length:425 Identity:130/425 - (30%)
Similarity:203/425 - (47%) Gaps:78/425 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MLDQLMGTTRN--GDERQ--LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYE 77
            :||:|||..||  .||::  :::....|||.:|...||.::..:||.|||.|.|:||...|..||
  Rat     7 LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYE 71

  Fly    78 SAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEVA----EKANAVHGLAEEI 138
            .:::.....|:.:.:.:||:.:|:.:||......||..:|.:.::..|    :....:..|.::|
  Rat    72 KSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKI 136

  Fly   139 GKKLAKAEALGEAGEVEDSMELMKEIEELRAKKIKAEHEYRTSMPAS----TYQQQKLRVCEVCS 199
            ...|.:.|.||..|:||::..:||.:|:|     |.|.|...|..::    ..|::::.|||||.
  Rat   137 DVLLQQIEELGSEGKVEEAQGMMKLVEQL-----KEERELLRSTTSTIESFAAQEKQMEVCEVCG 196

  Fly   200 AYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTAAPRKAELKRTGKMTDREDEGRGRNRYF 264
            |:|.:.|...|:.||..||.|:|:..|:..:.||       |.:|::..:..||           
  Rat   197 AFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL-------KEKLRKRTEEPDR----------- 243

  Fly   265 VGGRELDRRSRVHRSRSRERQRNRDGDRERPNNGRGPEEKGSERPKEAADGPERAERAPDR---G 326
                  |.|.:..:....||::.|:.:||.....|..||:  ||.||.|...||.:|:..|   .
  Rat   244 ------DERLKKEKQEREEREKEREREREERERKRRREEE--EREKERARDRERRKRSRSRSRHS 300

  Fly   327 GRRDDRD-NHGRDH-RERERDGRRDRDRHGRNDRGRFGDRGGGGGGGGHHRDDRR-RSRSRER-- 386
            .|..||. :..||| |.|.||.||.|.|..|..|             .|.|.:|: |||||:|  
  Rat   301 SRTSDRRCSRSRDHKRSRSRDRRRSRSRDRRRSR-------------SHDRSERKHRSRSRDRRR 352

  Fly   387 -SPRERRNFNHFRDGGGGGNGQRKRSYSRERNYRR 420
             ..|:|:::.|             ||.||:|...|
  Rat   353 SKSRDRKSYKH-------------RSKSRDREQDR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7564NP_001261989.1 LUC7 11..248 CDD:227527 75/242 (31%)
LUC7 12..246 CDD:281222 75/240 (31%)
Luc7l3NP_001101761.1 LUC7 4..244 CDD:227527 77/265 (29%)
LUC7 4..240 CDD:281222 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55077
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.