DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7564 and FMC1-LUC7L2

DIOPT Version :9

Sequence 1:NP_001261989.1 Gene:CG7564 / 39956 FlyBaseID:FBgn0036734 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001231513.1 Gene:FMC1-LUC7L2 / 100996928 HGNCID:44671 Length:458 Species:Homo sapiens


Alignment Length:405 Identity:204/405 - (50%)
Similarity:254/405 - (62%) Gaps:52/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TTRNGDERQLKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYD 88
            |||    :::||||.|||||.||:|||||:|:.||||||||.||||||.|||||.|:|.:|::::
Human    89 TTR----QRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFE 149

  Fly    89 IEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEVAEKANAVHGLAEEIGKKLAKAEALGEAGE 153
            ::||:|||:|||||||||:.||:||.|||||::||||.||..||.|.|||||.|||.|.||..|.
Human   150 LDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGN 214

  Fly   154 VEDSMELMKEIEELRAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGK 218
            ||:|.::|.|:|:.||||.:||..||.|||||::||||||||||||||||:||||.|||||||||
Human   215 VEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGK 279

  Fly   219 LHLGFLTIREKLIELEKTAAPRKAELKRTGKMTDREDEGRGRNRYFVGGRELDRRSRVH-----R 278
            |||||:.|||||.||::..| .|.|.:...::..||:..|..       ||..||||.|     |
Human   280 LHLGFIEIREKLEELKRVVA-EKQEKRNQERLKRREEREREE-------REKLRRSRSHSKNPKR 336

  Fly   279 SRSRE--RQRNRDGDRERPNNGRGPEEKGSERPKEAADGPERAERAPDRGGRRDDRDNHGRDHRE 341
            |||||  |.|:|...|||....|....:...|.:..:....|:        |...|..|....|.
Human   337 SRSREHRRHRSRSMSRERKRRTRSKSREKRHRHRSRSSSRSRS--------RSHQRSRHSSRDRS 393

  Fly   342 RERDGRRDRDRHGRNDRGRFGDRGGGGGGGGHHRD----DRRRSRSRERSPRERRNFNHFR--DG 400
            |||..|       |:.:.||.|           :|    ||.|| ||:||||:|...:..|  :.
Human   394 RERSKR-------RSSKERFRD-----------QDLASCDRDRS-SRDRSPRDRDRKDKKRSYES 439

  Fly   401 GGGGNGQRKRSYSRE 415
            ..|.:..|:.|..||
Human   440 ANGRSEDRRSSEERE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7564NP_001261989.1 LUC7 11..248 CDD:227527 149/223 (67%)
LUC7 12..246 CDD:281222 149/221 (67%)
FMC1-LUC7L2NP_001231513.1 Complex1_LYR_2 9..101 CDD:289975 7/15 (47%)
LUC7 89..294 CDD:227527 144/208 (69%)
LUC7 91..307 CDD:281222 147/220 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499212at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103514
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.