DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp74D and CG30278

DIOPT Version :9

Sequence 1:NP_001163460.1 Gene:Oatp74D / 39954 FlyBaseID:FBgn0036732 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster


Alignment Length:202 Identity:36/202 - (17%)
Similarity:60/202 - (29%) Gaps:74/202 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 ALIEP------------TCSAA---LNCTCDKENFAPICA--DGKMYISACHAGC---------S 631
            |:|||            .||..   |....||.....:|.  :..::.:.|.|.|         :
  Fly    54 AVIEPDGPVRQEINIRAECSKGRPLLESDKDKLRCCTMCVAQEQNLHPNLCSAQCRPLKTYLHLN 118

  Fly   632 SSSLRP-----------SDNRTLYSDCACIPDAPEAVNGYCDNNCKNFIYFILIFAICVFMHSTS 685
            ..:.||           .||.|:...|..:..........| .:|.|.:|         :.:..:
  Fly   119 EWTKRPLPKPTYKHSVILDNNTIVGRCFPMKFQLRRTKKNC-LDCGNELY---------YRYPIT 173

  Fly   686 EVGSMLLVMRC----THPKDKAMAMGVIQ----SAIGLFGNVPCPIIYGAVVDSACLIWKSVCGK 742
            ....:||:..|    .:|..|...|..::    |.:..|.|                   |:..:
  Fly   174 NNSDLLLIKNCCEVEVYPAKKVENMNNVRVTKISGVKKFAN-------------------SLLKE 219

  Fly   743 HGACSLY 749
            |..|.|:
  Fly   220 HSECRLF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oatp74DNP_001163460.1 OATP 175..754 CDD:335235 36/202 (18%)
CG30278NP_001286710.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.