DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qjt and MMS21

DIOPT Version :9

Sequence 1:NP_001261988.1 Gene:qjt / 39952 FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_010896.3 Gene:MMS21 / 856695 SGDID:S000000745 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:240 Identity:42/240 - (17%)
Similarity:88/240 - (36%) Gaps:37/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NYLADSALSTLVENKKFFKEMSDFVSDFSDGGKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKA 68
            |.|.||...:.:..:   ::::|..|.:       |||.....:|.....::..:|...:..:.|
Yeast    46 NQLVDSTSPSTIGIE---EQVADITSTY-------KLLSTYESESNSFDEHIKDLKKNFKQSSDA 100

  Fly    69 MNQV--------KNSSATIEEFEEVWKERSKAVEQKRINVKNLHEFKNFVKAVESAAGQAGAEVN 125
            ..|:        :....|..:..|::  .:....:....|.|....| .:|.:..........:.
Yeast   101 CPQIDLSTWDKYRTGELTAPKLSELY--LNMPTPEPATMVNNTDTLK-ILKVLPYIWNDPTCVIP 162

  Fly   126 DQANGTAYDEDLIMEDSGSEVFSFYDPWSKALIKNPMRNKMCGHIYDRDSVMPIIMDRIGIRCPV 190
            |..| .|.::||.:|....|:..   |.:....:.|:.::.|.|::|||.:...:.......||.
Yeast   163 DLQN-PADEDDLQIEGGKIELTC---PITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQ 223

  Fly   191 LGCANLCYIQPDHLVQDANVQQKI----------QQSMSNAIVDV 225
            ..|:.:  :.....|:|..::.:.          |...|:..:||
Yeast   224 AACSQV--VSMRDFVRDPIMELRCKIAKMKESQEQDKRSSQAIDV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qjtNP_001261988.1 RING 135..194 CDD:302633 13/58 (22%)
MMS21NP_010896.3 COG5627 1..267 CDD:227914 42/240 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.