DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qjt and HPY2

DIOPT Version :9

Sequence 1:NP_001261988.1 Gene:qjt / 39952 FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_188133.2 Gene:HPY2 / 820746 AraportID:AT3G15150 Length:249 Species:Arabidopsis thaliana


Alignment Length:238 Identity:52/238 - (21%)
Similarity:100/238 - (42%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STLVENKKFFKEMSDFVSDFSDGGKIKKL--LEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKN 74
            |||.:.:|....|.:.........:..|:  ||.||.:.::     :|....|:|  .|:..|.|
plant    27 STLADIRKAVAMMKNIAVQLEKENQTDKVKDLENSVAELLD-----LHSDCNHRS--TAIQSVAN 84

  Fly    75 SSATIEEFEEVWK----ERSKAVEQKRINVKNLHEFKNFVKAVESAAGQAGAEVNDQANGTAYDE 135
            ....:|:..:..|    |.:|.........:|.|..:.|.:||.:..........|.      ||
plant    85 RYQPVEQLTDFKKLLDDEFTKLKATPSSVPQNDHLMRQFREAVWNVHHAGEPMPGDD------DE 143

  Fly   136 DLIMEDSGSEVFSFYDPWS-KAL--IKNPMRNKMCGHIYDRDSVMPIIMDRIGIRCPVLGCANLC 197
            |::|..:...:.:...|.| |.:  :.:|:|:..|.|:|::..::..|::.....|||.||..  
plant   144 DIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDCRHVYEKSVILHYIVNNPNANCPVAGCRG-- 206

  Fly   198 YIQPDHLVQDANVQQKIQ-------QSMSNAIVDVTASEEDEE 233
            .:|...::.||.::.:|:       ||....:::....:.||:
plant   207 KLQNSKVICDAMLKFEIEEMRSLNKQSNRAEVIEDFTEDVDED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qjtNP_001261988.1 RING 135..194 CDD:302633 16/61 (26%)
HPY2NP_188133.2 SPL-RING_NSE2 157..225 CDD:319565 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2626
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.