DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qjt and Nsmce2

DIOPT Version :9

Sequence 1:NP_001261988.1 Gene:qjt / 39952 FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001361697.1 Gene:Nsmce2 / 68501 MGIID:1915751 Length:273 Species:Mus musculus


Alignment Length:228 Identity:59/228 - (25%)
Similarity:105/228 - (46%) Gaps:41/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YLADSALSTLVENKKFFKEMSDFVSDFSDGGKIKKLLEQSVEQSVEHA-----VNVVHMKIKHQS 64
            |..|.|   :||..|..:|:|.:|              ::|:.::.|.     ..|..:|:..:.
Mouse    59 YSMDKA---MVEFAKMDRELSHYV--------------KAVQSTINHVKEERPEKVPDLKLLVEK 106

  Fly    65 LNKAMNQVKNSSATIEEFEEVWKERSKAVEQKRINVK----NLH-EF---KNFVKAVESAAGQAG 121
            ...|: |.|||.|..:|.|:..:.:.:..|.|:..||    ..| ||   |:..:|.....|...
Mouse   107 KFLAL-QDKNSDADFKENEKFVQFKQQLRELKKQLVKPKEDGRHSEFDPNKDSSRAGNKRDGIHA 170

  Fly   122 AEVNDQANGTAYDEDLIMEDSGSEVFSFYDPWSKALIKNPMRNKMCGHIYDRDSVMPIIMDRIGI 186
            ...||...|.  |||:|:..|.:   :|..|.::..:|.|::||||||.|:.::::.:|..:...
Mouse   171 DRENDLTEGV--DEDMIVTQSQT---NFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKR 230

  Fly   187 R----CPVLGCANLCYIQPDHLVQDANVQQKIQ 215
            :    ||.:||::......| |:.|..:::.|:
Mouse   231 KKKACCPKIGCSHTDMRMSD-LIPDEALRRAIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qjtNP_001261988.1 RING 135..194 CDD:302633 19/62 (31%)
Nsmce2NP_001361697.1 SPL-RING_NSE2 193..262 CDD:319565 19/69 (28%)
SPL-RING finger 195..241 CDD:319565 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12442
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5448
Isobase 1 0.950 - 0 Normalized mean entropy S7995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto93116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5680
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.900

Return to query results.
Submit another query.