DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qjt and Nsmce2

DIOPT Version :9

Sequence 1:NP_001261988.1 Gene:qjt / 39952 FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_017450247.1 Gene:Nsmce2 / 299957 RGDID:1305156 Length:273 Species:Rattus norvegicus


Alignment Length:248 Identity:59/248 - (23%)
Similarity:104/248 - (41%) Gaps:46/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DSALSTLVENKKFFKEMSDFVSDF------------SDGGKIKKLLE-QSVEQSVEHAVNVVHMK 59
            :||||:|...:.......|.||..            |:....|.::| ..:::.:.|.|..|...
  Rat    21 ESALSSLKTFQSCISSGMDTVSSVALDLVETQTEVSSEYSMDKAMVEFAKMDRELNHYVKAVQST 85

  Fly    60 IKHQSLNKAMN---------------QVKNSSATIEEFEEVWKERSKAVEQKRINVK-----NLH 104
            |.|....:...               |.|||.|..:|.|:..:.:.:..|.|:..||     ..:
  Rat    86 INHVKEERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQLRELKKQLVKPREDGRHN 150

  Fly   105 EF---KNFVKAVESAAGQAGAEVNDQANGTAYDEDLIMEDSGSEVFSFYDPWSKALIKNPMRNKM 166
            ||   |:..:......|......||...|  .|||:|:..|.:   :|..|.::..:|.|::|||
  Rat   151 EFDPNKDSSRTGNERDGIHADRENDGIEG--MDEDMIVTQSQT---NFICPITQLEMKKPVKNKM 210

  Fly   167 CGHIYDRDSVMPIIMDRIGIR----CPVLGCANLCYIQPDHLVQDANVQQKIQ 215
            |||.|:.::::.:|..:...:    ||.:||::......| |:.|..:::.|:
  Rat   211 CGHTYEEEAIVRMIESKHKRKKKACCPKIGCSHTDMRMSD-LIPDEALRRAIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qjtNP_001261988.1 RING 135..194 CDD:302633 19/62 (31%)
Nsmce2XP_017450247.1 zf-Nse 182..242 CDD:288622 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12168
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5359
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto96668
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.