DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qjt and ZK1248.11

DIOPT Version :9

Sequence 1:NP_001261988.1 Gene:qjt / 39952 FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001380006.1 Gene:ZK1248.11 / 173987 WormBaseID:WBGene00022881 Length:201 Species:Caenorhabditis elegans


Alignment Length:213 Identity:59/213 - (27%)
Similarity:98/213 - (46%) Gaps:50/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SALSTLVENKKFFKE--MSDFVSDFSDGGKIKKLLEQSVE-QSVEHAVNVVHMKIKHQSLNKAMN 70
            :|:|..|:::: |||  |.|.:          ||:|...| ..::|....:|..:|..|     :
 Worm    30 NAISNEVDSEE-FKETLMKDAM----------KLMELETEGAQMQHIFEALHNDLKDGS-----D 78

  Fly    71 QVKNSSATIEEFEEVWKERSKAVEQKRINVKNLHEFKNFVKAVESAAGQAGAEVNDQANGTAYDE 135
            :|.|..| :||..|..|:..|.|:.:|      ..||:.:|::...:      .||:      :|
 Worm    79 EVPNEKA-LEELYEKAKKTHKNVKGER------QYFKDIIKSIRDES------KNDE------NE 124

  Fly   136 DLIMEDSGSEVFSFYDPWSKALIKNPMRNKMCGHIYDRDSVMPIIMDRIGIRCPVLGCANLCYI- 199
            ..:|:...|.    .||.||..|.||:.:|.|||:|||||:......:..|:|.:.||:....| 
 Worm   125 MEVMQVQHSR----KDPISKKDIVNPVISKNCGHVYDRDSIHEFAGKKRVIKCAMQGCSETINIG 185

  Fly   200 ----QPDHLVQDANVQQK 213
                .||:.   .|::|:
 Worm   186 QLADYPDYW---TNIKQQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qjtNP_001261988.1 RING 135..194 CDD:302633 22/58 (38%)
ZK1248.11NP_001380006.1 SPL-RING_NSE2 134..199 CDD:319565 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8246
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4090
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.