DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qjt and nsmce2

DIOPT Version :9

Sequence 1:NP_001261988.1 Gene:qjt / 39952 FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_031759369.1 Gene:nsmce2 / 100497178 XenbaseID:XB-GENE-13579717 Length:238 Species:Xenopus tropicalis


Alignment Length:189 Identity:47/189 - (24%)
Similarity:93/189 - (49%) Gaps:36/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LEQSVEQSVEHAVNVVHMKIKHQSLNKA---MNQVKNSSATIE--EFEEVWKERSKAVEQKRINV 100
            :|:.:.|.: |||.....|::.:.:.:.   ::||:...|||:  ..:|..|:..:.|       
 Frog    65 MERDLNQYI-HAVEETVQKLRREQIEQVPDLLSQVQEKYATIQGKNTDEDLKKNGRFV------- 121

  Fly   101 KNLHEFKNFVKAVESAAGQAGAEVNDQANGT--AYDEDLIMEDSGSEVFSFYDPWSKALIKNPMR 163
                :||:.::.:....|:     .::..|.  ..|||:.:..|..   :|..|.::..:.||::
 Frog   122 ----QFKDQLREMRKQMGE-----KEEGEGAFENVDEDIAVMPSQQ---NFTCPITQMKMTNPVK 174

  Fly   164 NKMCGHIYDRDSVMPIIMDRIGIR----CPVLGC----ANLCYIQPDHLVQDA-NVQQK 213
            ||:|||.|:::::..||.|:...:    ||::||    ..|..:.||.|::.| :||.|
 Frog   175 NKVCGHTYEKEAIERIIQDKHQRKKRATCPIIGCDHSDMQLSDLGPDTLLKRAIDVQNK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qjtNP_001261988.1 RING 135..194 CDD:302633 20/66 (30%)
nsmce2XP_031759369.1 SPL-RING_NSE2 160..229 CDD:319565 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12191
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto103372
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.