powered by:
Protein Alignment UQCR-Q and QCR8
DIOPT Version :9
Sequence 1: | NP_001189124.1 |
Gene: | UQCR-Q / 39950 |
FlyBaseID: | FBgn0036728 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012369.1 |
Gene: | QCR8 / 853273 |
SGDID: | S000003702 |
Length: | 94 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 55 |
Identity: | 18/55 - (32%) |
Similarity: | 28/55 - (50%) |
Gaps: | 2/55 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 HFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSN-VFIVTPPFIVGY 64
|.|. .|..||.:|.:||:.|:...|.....:.|..|||:|. ::::.|..|..|
Yeast 15 HMGG-PKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWY 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
UQCR-Q | NP_001189124.1 |
UcrQ |
11..86 |
CDD:397200 |
18/55 (33%) |
QCR8 | NP_012369.1 |
UcrQ |
12..89 |
CDD:397200 |
18/55 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345173 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4116 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005141 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105128 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12119 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1050 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
8 | 7.820 |
|
Return to query results.
Submit another query.