DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and QCR8

DIOPT Version :10

Sequence 1:NP_648985.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_012369.1 Gene:QCR8 / 853273 SGDID:S000003702 Length:94 Species:Saccharomyces cerevisiae


Alignment Length:55 Identity:18/55 - (32%)
Similarity:28/55 - (50%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSN-VFIVTPPFIVGY 64
            |.|. .|..||.:|.:||:.|:...|.....:.|..|||:|. ::::.|..|..|
Yeast    15 HMGG-PKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWY 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_648985.1 UcrQ 11..86 CDD:460757 18/55 (33%)
QCR8NP_012369.1 UcrQ 12..89 CDD:460757 18/55 (33%)

Return to query results.
Submit another query.