DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and QCR8

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_012369.1 Gene:QCR8 / 853273 SGDID:S000003702 Length:94 Species:Saccharomyces cerevisiae


Alignment Length:55 Identity:18/55 - (32%)
Similarity:28/55 - (50%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSN-VFIVTPPFIVGY 64
            |.|. .|..||.:|.:||:.|:...|.....:.|..|||:|. ::::.|..|..|
Yeast    15 HMGG-PKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWY 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 18/55 (33%)
QCR8NP_012369.1 UcrQ 12..89 CDD:397200 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4116
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105128
Panther 1 1.100 - - LDO PTHR12119
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1050
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.