DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and uqcrq

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001016654.1 Gene:uqcrq / 549408 XenbaseID:XB-GENE-977452 Length:82 Species:Xenopus tropicalis


Alignment Length:81 Identity:42/81 - (51%)
Similarity:58/81 - (71%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNVFIVTPPFIVGYLIYDLTERK 73
            |:|||:||||..|::|.|||||||||....|||:||:.||||..||.|.|||::.|::|....:.
 Frog     2 GRHFGDLAKVRHIISYSLSPFEQRAFPHYFSKGIPNVWRRFRGQVFKVVPPFVLSYIVYSWGTQV 66

  Fly    74 HTALLRKNPADYANDE 89
            |:.|.:|:.:.|.||:
 Frog    67 HSDLKKKDLSLYENDQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 38/74 (51%)
uqcrqNP_001016654.1 UcrQ 4..79 CDD:367261 38/74 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8187
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40942
Inparanoid 1 1.050 92 1.000 Inparanoid score I4949
OMA 1 1.010 - - QHG49734
OrthoDB 1 1.010 - - D1523793at2759
OrthoFinder 1 1.000 - - FOG0005141
OrthoInspector 1 1.000 - - oto103336
Panther 1 1.100 - - LDO PTHR12119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1050
SonicParanoid 1 1.000 - - X5494
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.