DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and Uqcrq

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:XP_038942489.1 Gene:Uqcrq / 497902 RGDID:1562350 Length:101 Species:Rattus norvegicus


Alignment Length:95 Identity:32/95 - (33%)
Similarity:50/95 - (52%) Gaps:18/95 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNVFIVTP------------PFI 61
            |:.||||.::..:::|.|||||||||....|||:||::||.|..:..|.|            ||:
  Rat     2 GREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPRECGAGGVRPRAPFL 66

  Fly    62 ------VGYLIYDLTERKHTALLRKNPADY 85
                  :.:|.|.....|.|.:...:|:::
  Rat    67 PTSSTDMEFLSYRNDWPKVTWVTPTSPSEH 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 31/93 (33%)
UqcrqXP_038942489.1 UcrQ 4..>51 CDD:397200 23/46 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348821
Domainoid 1 1.000 80 1.000 Domainoid score I8427
eggNOG 1 0.900 - - E1_KOG4116
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40942
Inparanoid 1 1.050 87 1.000 Inparanoid score I5056
OMA 1 1.010 - - QHG49734
OrthoDB 1 1.010 - - D1523793at2759
OrthoFinder 1 1.000 - - FOG0005141
OrthoInspector 1 1.000 - - oto96634
orthoMCL 1 0.900 - - OOG6_105128
Panther 1 1.100 - - LDO PTHR12119
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5494
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.