DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and uqcrq

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001002495.2 Gene:uqcrq / 436768 ZFINID:ZDB-GENE-040718-199 Length:82 Species:Danio rerio


Alignment Length:81 Identity:44/81 - (54%)
Similarity:56/81 - (69%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNVFIVTPPFIVGYLIYDLTERK 73
            |.||||||||..::||.:|||||:|||...|||:||:.|||||:||.:.||..:.||.|......
Zfish     2 GLHFGNLAKVRHVITYSISPFEQKAFANYFSKGVPNLWRRFRSSVFKIAPPLALTYLTYTWGNHV 66

  Fly    74 HTALLRKNPADYANDE 89
            |....:|||||:.||:
Zfish    67 HEECKKKNPADFENDD 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 41/74 (55%)
uqcrqNP_001002495.2 UcrQ 4..79 CDD:281006 41/74 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589978
Domainoid 1 1.000 91 1.000 Domainoid score I7736
eggNOG 1 0.900 - - E1_KOG4116
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40942
Inparanoid 1 1.050 97 1.000 Inparanoid score I5036
OMA 1 1.010 - - QHG49734
OrthoDB 1 1.010 - - D1523793at2759
OrthoFinder 1 1.000 - - FOG0005141
OrthoInspector 1 1.000 - - oto38930
orthoMCL 1 0.900 - - OOG6_105128
Panther 1 1.100 - - LDO PTHR12119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1050
SonicParanoid 1 1.000 - - X5494
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.