DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and UQCRQ

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_055217.2 Gene:UQCRQ / 27089 HGNCID:29594 Length:82 Species:Homo sapiens


Alignment Length:81 Identity:38/81 - (46%)
Similarity:53/81 - (65%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNVFIVTPPFIVGYLIYDLTERK 73
            |:.||||.::..:::|.||||||||:....:||:||::||.|.:.|.|.|.|:|.||||.....:
Human     2 GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEE 66

  Fly    74 HTALLRKNPADYANDE 89
            .....|||||.|.||:
Human    67 FERSKRKNPAAYENDK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 34/74 (46%)
UQCRQNP_055217.2 UcrQ 4..79 CDD:367261 34/74 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154941
Domainoid 1 1.000 76 1.000 Domainoid score I9039
eggNOG 1 0.900 - - E1_KOG4116
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40942
Inparanoid 1 1.050 84 1.000 Inparanoid score I5188
Isobase 1 0.950 - 0 Normalized mean entropy S3796
OMA 1 1.010 - - QHG49734
OrthoDB 1 1.010 - - D1523793at2759
OrthoFinder 1 1.000 - - FOG0005141
OrthoInspector 1 1.000 - - oto89511
orthoMCL 1 0.900 - - OOG6_105128
Panther 1 1.100 - - LDO PTHR12119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1050
SonicParanoid 1 1.000 - - X5494
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.