DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and qcr8

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_594714.1 Gene:qcr8 / 2542357 PomBaseID:SPAC1782.07 Length:92 Species:Schizosaccharomyces pombe


Alignment Length:57 Identity:25/57 - (43%)
Similarity:29/57 - (50%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNVFIVTPPFIVGYLIY 67
            |.|. .|..||:||.||||:||..||.......||.||..:....|..||.:.|.||
pombe    16 HLGG-PKQKGIITYSLSPFQQRPMAGFFKTSTQNMFRRVMTEGLYVAIPFGIAYYIY 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 25/57 (44%)
qcr8NP_594714.1 UcrQ 13..88 CDD:281006 25/57 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I3526
eggNOG 1 0.900 - - E1_KOG4116
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I2077
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005141
OrthoInspector 1 1.000 - - oto101024
orthoMCL 1 0.900 - - OOG6_105128
Panther 1 1.100 - - LDO PTHR12119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1050
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.