DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and Uqcrq

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001313543.1 Gene:Uqcrq / 22272 MGIID:107807 Length:82 Species:Mus musculus


Alignment Length:81 Identity:41/81 - (50%)
Similarity:55/81 - (67%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNVFIVTPPFIVGYLIYDLTERK 73
            |:.|||||::..:::|.|||||||||....|||:||::||.|..:..|.|||:|.||||....::
Mouse     2 GREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQE 66

  Fly    74 HTALLRKNPADYANDE 89
            .....|||||.|.||:
Mouse    67 FEQSKRKNPAMYENDK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 37/74 (50%)
UqcrqNP_001313543.1 UcrQ 4..79 CDD:308539 37/74 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845411
Domainoid 1 1.000 82 1.000 Domainoid score I8460
eggNOG 1 0.900 - - E1_KOG4116
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40942
Inparanoid 1 1.050 89 1.000 Inparanoid score I5106
Isobase 1 0.950 - 0 Normalized mean entropy S3796
OMA 1 1.010 - - QHG49734
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005141
OrthoInspector 1 1.000 - - oto93082
orthoMCL 1 0.900 - - OOG6_105128
Panther 1 1.100 - - LDO PTHR12119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1050
SonicParanoid 1 1.000 - - X5494
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.