DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-Q and F45H10.2

DIOPT Version :9

Sequence 1:NP_001189124.1 Gene:UQCR-Q / 39950 FlyBaseID:FBgn0036728 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_496838.1 Gene:F45H10.2 / 174992 WormBaseID:WBGene00009739 Length:90 Species:Caenorhabditis elegans


Alignment Length:93 Identity:35/93 - (37%)
Similarity:55/93 - (59%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFRSNV----FIVTPPFI 61
            ||.:.:..|:|||||.|::|...:.|:|.||:|:.|...:.   .|:.|::.|    :...|..|
 Worm     1 MRPTVVSMGKHFGNLGKMYGEHRFALAPNEQKAYKGFFDQA---FVKTFKTYVWDQWYYYIPQTI 62

  Fly    62 VGYLIYDLTERKHTALLRKNPADYANDE 89
            ..||:||..::.:.|..||||||:|||:
 Worm    63 GAYLLYDWAKKTNVAANRKNPADFANDQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-QNP_001189124.1 UcrQ 11..86 CDD:397200 29/78 (37%)
F45H10.2NP_496838.1 UcrQ 11..87 CDD:281006 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163591
Domainoid 1 1.000 54 1.000 Domainoid score I7508
eggNOG 1 0.900 - - E1_KOG4116
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I3909
Isobase 1 0.950 - 0 Normalized mean entropy S3796
OMA 1 1.010 - - QHG49734
OrthoDB 1 1.010 - - D1523793at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14725
orthoMCL 1 0.900 - - OOG6_105128
Panther 1 1.100 - - LDO PTHR12119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1050
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.