DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecCl and GABRR2

DIOPT Version :9

Sequence 1:NP_001261986.1 Gene:SecCl / 39949 FlyBaseID:FBgn0036727 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_002034.3 Gene:GABRR2 / 2570 HGNCID:4091 Length:465 Species:Homo sapiens


Alignment Length:472 Identity:130/472 - (27%)
Similarity:220/472 - (46%) Gaps:81/472 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QRLTHVCRYDRLERPFEYDSDGKRLPIVVKTRIYVYFLQNLNSDLLQFKMHALLQLRFQDKRLAY 113
            |:|..|..:|...||   ...|..:|:.|.  :.|..|.:::...:.|.|...|:..::|:|||:
Human    56 QQLLRVDEHDFSMRP---AFGGPAIPVGVD--VQVESLDSISEVDMDFTMTLYLRHYWKDERLAF 115

  Fly   114 -KAFNRSDNILGQKHLSERLWLPHIFFANERESSILGTDEKDVLTSLSPEGNVIISTRMQASLYC 177
             .|.|:|....|:  |.:::|:|.:||.:.:.|....|...:::..:.|:|:|:.|.|:..:..|
Human   116 SSASNKSMTFDGR--LVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMC 178

  Fly   178 WMNFQKFPFDQQFCSTVLESWMYNTSDLILEWE-PHTPISFDPEMRLTEYNMAQFWHNTTIVQSD 241
            .|:|..||.|.|.||..|||:.|...||:|.|: ....:..|.::.|::: :.|.:|.|:     
Human   179 NMDFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQF-LIQKFHTTS----- 237

  Fly   242 GDNLRHGAFAGNYSSLSFTVNLKREIGFYLLDYYLPSMMIVAISWVSFWLQADASPPRIMLGTST 306
              .|...:..|.|:.|.....|:|.|.|:||..|.|:.::|.:||||||:...|.|.|:.||.:|
Human   238 --RLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT 300

  Fly   307 MLSFITLSSSQSKNLPKVSYIKVSEVWFLGCTFFIFGSLVEFAFVN---TIWRRKENIELKKVNS 368
            :|:..|:.:..:.::|:|||:|..:::......|:|.|::|:|.||   |:..|||    :|:..
Human   301 VLTMTTIITGVNASMPRVSYVKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKE----RKLRE 361

  Fly   369 KY------IIKSTLTPRPARRQIGGSLSNESRARSCSSLDNIVSSTESVRNGNGTVNQGFNNYLT 427
            |:      :...|:       .:.||.| ||.|.|.:........||..|.....|:.|.:.   
Human   362 KFPCMCGMLHSKTM-------MLDGSYS-ESEANSLAGYPRSHILTEEERQDKIVVHLGLSG--- 415

  Fly   428 VHPNLPIIRTECAEADTVSICSART-----NNDHIVDVDKDKKDTPPTFTTMTPQEIAMWIDRRS 487
                      |...|....:...:|     .|.|.                         ||:.|
Human   416 ----------EANAARKKGLLKGQTGFRIFQNTHA-------------------------IDKYS 445

  Fly   488 RFLFPAMFLAFNALYWT 504
            |.:|||.::.||.:||:
Human   446 RLIFPASYIFFNLIYWS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecClNP_001261986.1 LIC 43..505 CDD:273305 130/472 (28%)
Neur_chan_LBD 44..267 CDD:280998 62/219 (28%)
Neur_chan_memb 275..503 CDD:280999 62/241 (26%)
GABRR2NP_002034.3 Neur_chan_LBD 51..464 CDD:332142 130/472 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.