DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecCl and GABRD

DIOPT Version :9

Sequence 1:NP_001261986.1 Gene:SecCl / 39949 FlyBaseID:FBgn0036727 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_016856425.1 Gene:GABRD / 2563 HGNCID:4084 Length:687 Species:Homo sapiens


Alignment Length:464 Identity:118/464 - (25%)
Similarity:201/464 - (43%) Gaps:113/464 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PIVVKTRIYVYFLQNLNSDLLQFKMHALLQLRFQDKRLAYKAFNRSDNILG-QKHLSERLWLPHI 137
            |:.|...:.|..:.:::...:::.|...|...::|.||:|   |.::..|| .....::||||..
Human   298 PVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSY---NHTNETLGLDSRFVDKLWLPDT 359

  Fly   138 FFANERESSILGTDEKDVLTSLSPEGNVIISTRMQASLYCWMNFQKFPFDQQFCSTVLESWMYNT 202
            |..|.:.:.......::.|..|.|:|.::.|.|:.:::.|.|:..|:|.|:|.|...|||:.|::
Human   360 FIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECMLDLESYGYSS 424

  Fly   203 SDLILEW-EPHTPISFDPEMRLTEYNMAQFWHNTTIVQSDGDNLRHGAFAGNYSSLSFTVNLKRE 266
            .|::..| |....|....:::|.::.:..:...|.::     |.:.   ||.:..||...:|:|.
Human   425 EDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELM-----NFKS---AGQFPRLSLHFHLRRN 481

  Fly   267 IGFYLLDYYLPSMMIVAISWVSFWLQADASPPRIMLGTSTMLSFITLSSSQSKNLPKVSYIKVSE 331
            .|.|::..|:||:::||:||||||:...|.|.|:.||.:|:|:..||..|...:||:.|.||..:
Human   482 RGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSSLPRASAIKALD 546

  Fly   332 VWFLGCTFFIFGSLVEFAFV--NTIWRRKENIELK--------KVNSKYIIKS----------TL 376
            |:|..|..|:|.:|||:||.  |..:|:|:..::|        .|.:..::.|          .:
Human   547 VYFWICYVFVFAALVEYAFAHFNADYRKKQKAKVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAI 611

  Fly   377 TPRPAR---------RQIG---GSLSNESRARSCSSLDNIVSSTESVRNGNGTVNQGFNNYLTVH 429
            :.|..|         |.:|   |....|..|||               .|.|.:.          
Human   612 SRRQRRVPGNLMGSYRSVGVETGETKKEGAARS---------------GGQGGIR---------- 651

  Fly   430 PNLPIIRTECAEADTVSICSARTNNDHIVDVDKDKKDTPPTFTTMTPQEIAMWIDRRSRFLFPAM 494
                 .|....:|||                                      ||..:|.:|||.
Human   652 -----ARLRPIDADT--------------------------------------IDIYARAVFPAA 673

  Fly   495 FLAFNALYW 503
            |.|.|.:||
Human   674 FAAVNVIYW 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecClNP_001261986.1 LIC 43..505 CDD:273305 118/464 (25%)
Neur_chan_LBD 44..267 CDD:280998 48/194 (25%)
Neur_chan_memb 275..503 CDD:280999 66/259 (25%)
GABRDXP_016856425.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.