DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecCl and GABRA5

DIOPT Version :9

Sequence 1:NP_001261986.1 Gene:SecCl / 39949 FlyBaseID:FBgn0036727 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_000801.1 Gene:GABRA5 / 2558 HGNCID:4079 Length:462 Species:Homo sapiens


Alignment Length:461 Identity:117/461 - (25%)
Similarity:206/461 - (44%) Gaps:89/461 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YDRLERPFEYDSDGKRLPIVVKTRIYVYFLQNLNSDLLQFKMHALLQLRFQDKRLAYKAFNRS-- 119
            ||...||    ..|:|: ..|:|.|||.....::...:::.:....:..::|:||.:|...:.  
Human    60 YDNRLRP----GLGERI-TQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLP 119

  Fly   120 -DNILGQKHLSERLWLPHIFFANERESSILGTDEKDVLTSLSPEGNVIISTRMQASLYCWMNFQK 183
             :|:|..|     :|.|..||.|.::|........:.|..|..:|.::.:.|:..|..|.|..:.
Human   120 LNNLLASK-----IWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLED 179

  Fly   184 FPFDQQFCSTVLESWMYNTSDLILEW---EPHTPISFDPEMRLTEYN-MAQFWHNTTIVQSDGDN 244
            ||.|...|.....|:.|..|:::..|   ...:.:..:...||.:|: |.|......|..|.|: 
Human   180 FPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGE- 243

  Fly   245 LRHGAFAGNYSSLSFTVNLKREIGFYLLDYYLPSMMIVAISWVSFWLQADASPPRIMLGTSTMLS 309
                     |:.::...:|||:||::::..|||.:|.|.:|.|||||..::.|.|.:.|.:|:|:
Human   244 ---------YTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLT 299

  Fly   310 FITLSSSQSKNLPKVSYIKVSEVWFLG-CTFFIFGSLVEFAFVNTI------WRRKENIELKKVN 367
            ..|||.|...:||||:|....: ||:. |..|:|.:|:|||.||..      |..|:.:|..|:.
Human   300 MTTLSISARNSLPKVAYATAMD-WFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIK 363

  Fly   368 SKYIIKSTLTPRPARRQIGGSLSNESRARSCSSLDNIVSSTESVRNGNGTVNQGFNNYLTVHPNL 432
            .|             |::   :.|:              ||.:...|.          ::..||:
Human   364 KK-------------REV---ILNK--------------STNAFTTGK----------MSHPPNI 388

  Fly   433 PIIRTECAEADTVSICSARTNNDHIVDVDKDKKDTPPTFTTMTPQEIAMWIDRRSRFLFPAMFLA 497
            |..:|....::|.|:        .:...::...::..|:.:::.      ||:.||.:||.:|..
Human   389 PKEQTPAGTSNTTSV--------SVKPSEEKTSESKKTYNSISK------IDKMSRIVFPVLFGT 439

  Fly   498 FNALYW 503
            ||.:||
Human   440 FNLVYW 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecClNP_001261986.1 LIC 43..505 CDD:273305 117/461 (25%)
Neur_chan_LBD 44..267 CDD:280998 51/216 (24%)
Neur_chan_memb 275..503 CDD:280999 62/234 (26%)
GABRA5NP_000801.1 LGIC_ECD_GABAAR_A5 58..256 CDD:349839 50/215 (23%)
LGIC_TM_GABAAR_alpha 259..445 CDD:349854 62/240 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..412 7/52 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.