DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecCl and GABRA3

DIOPT Version :9

Sequence 1:NP_001261986.1 Gene:SecCl / 39949 FlyBaseID:FBgn0036727 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_000799.1 Gene:GABRA3 / 2556 HGNCID:4077 Length:492 Species:Homo sapiens


Alignment Length:474 Identity:126/474 - (26%)
Similarity:211/474 - (44%) Gaps:74/474 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TQLIQRLTHVCRYDRLERPFEYDSDGKRLPIVVKTRIYVYFLQNLNSDLLQFKMHALLQLRFQDK 109
            |:::.||  :..||...||...|:..:     |||.|||.....::...:::.:....:..:.|:
Human    68 TRILDRL--LDGYDNRLRPGLGDAVTE-----VKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE 125

  Fly   110 RLAYKAFNRSDNILGQKH-LSERLWLPHIFFANERESSILGTDEKDVLTSLSPEGNVIISTRMQA 173
            ||   .|:....||...: |:.::|.|..||.|.::|........:.|..|...|.::.:.|:..
Human   126 RL---KFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTI 187

  Fly   174 SLYCWMNFQKFPFDQQFCSTVLESWMYNTSDLILEW----EPHTPISFDPEMRLTEYNMAQFWHN 234
            ...|.|:.:.||.|...|.....|:.|.|::::..|    .....::.|.. ||.:|::......
Human   188 HAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGS-RLNQYDLLGHVVG 251

  Fly   235 TTIVQSDGDNLRHGAFAGNYSSLSFTVNLKREIGFYLLDYYLPSMMIVAISWVSFWLQADASPPR 299
            |.|::|.         .|.|..::...:|||:||::::..|||.:|.|.:|.|||||..::.|.|
Human   252 TEIIRSS---------TGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPAR 307

  Fly   300 IMLGTSTMLSFITLSSSQSKNLPKVSYIKVSEVWFLG-CTFFIFGSLVEFAFVNTIWRRKENIEL 363
            .:.|.:|:|:..|||.|...:||||:|....: ||:. |..|:|.:|:|||.||...:|....|.
Human   308 TVFGVTTVLTMTTLSISARNSLPKVAYATAMD-WFIAVCYAFVFSALIEFATVNYFTKRSWAWEG 371

  Fly   364 KKVNSKYIIKSTLTPRPARRQIGGSLSNESRARSCSSLDNIVSSTESVRNGNGTVNQGFNNYLTV 428
            |||.....:|......||::              .|:..|||.:|                    
Human   372 KKVPEALEMKKKTPAAPAKK--------------TSTTFNIVGTT-------------------- 402

  Fly   429 HPNLPIIRTECAEADTVSICSARTNNDHIVDVDKDKKDTPPTFTTMTPQEIAMW-----IDRRSR 488
               .||...:..|..|:|..:|.:.:.....:...|    .|:...:|.|...:     :|:.||
Human   403 ---YPINLAKDTEFSTISKGAAPSASSTPTIIASPK----ATYVQDSPTETKTYNSVSKVDKISR 460

  Fly   489 FLFPAMFLAFNALYW-TFV 506
            .:||.:|..||.:|| |:|
Human   461 IIFPVLFAIFNLVYWATYV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecClNP_001261986.1 LIC 43..505 CDD:273305 124/471 (26%)
Neur_chan_LBD 44..267 CDD:280998 53/226 (23%)
Neur_chan_memb 275..503 CDD:280999 67/233 (29%)
GABRA3NP_000799.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..54
LIC 69..478 CDD:273305 123/470 (26%)
LGIC_ECD_GABAAR_A3 75..274 CDD:349837 49/216 (23%)
Cys-loop 191..205 CDD:349837 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.