DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SecCl and GABRA1

DIOPT Version :9

Sequence 1:NP_001261986.1 Gene:SecCl / 39949 FlyBaseID:FBgn0036727 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_000797.2 Gene:GABRA1 / 2554 HGNCID:4075 Length:456 Species:Homo sapiens


Alignment Length:520 Identity:139/520 - (26%)
Similarity:225/520 - (43%) Gaps:109/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSEIFWITLILVLSIWT--SVGVKAEEEECPSMADA---GSLQQTQLIQRLTHVCRYDRLERPFE 65
            ||:..| ..||:||..|  |.|.       ||:.|.   .:...|:::.||  :..||...||  
Human     7 LSDCLW-AWILLLSTLTGRSYGQ-------PSLQDELKDNTTVFTRILDRL--LDGYDNRLRP-- 59

  Fly    66 YDSDGKRLPIVVKTRIYVYFLQNLNSDLLQFKMHALLQLRFQDKRLAYK---AFNRSDNILGQKH 127
              ..|:|: ..|||.|:|.....::...:::.:....:..::|:||.:|   ...|.:|::..| 
Human    60 --GLGERV-TEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK- 120

  Fly   128 LSERLWLPHIFFANERESSILGTDEKDVLTSLSPEGNVIISTRMQASLYCWMNFQKFPFDQQFCS 192
                :|.|..||.|.::|........:.|..::.:|.::.:.|:.....|.|:.:.||.|...|.
Human   121 ----IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP 181

  Fly   193 TVLESWMYNTSDLILEW--EP-HTPISFDPEMRLTEYNMAQFWHNTTIVQSDGDNLRHGAFAGNY 254
            ....|:.|..::::.||  || .:.:..:...||.:|::.....::.||||.         .|.|
Human   182 LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSS---------TGEY 237

  Fly   255 SSLSFTVNLKREIGFYLLDYYLPSMMIVAISWVSFWLQADASPPRIMLGTSTMLSFITLSSSQSK 319
            ..::...:|||:||::::..|||.:|.|.:|.|||||..::.|.|.:.|.:|:|:..|||.|...
Human   238 VVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARN 302

  Fly   320 NLPKVSYIKVSEVWFLG-CTFFIFGSLVEFAFVNTI------WRRKENI--ELKKVNSKYIIKST 375
            :||||:|....: ||:. |..|:|.:|:|||.||..      |..|..:  :.|||... :||..
Human   303 SLPKVAYATAMD-WFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP-LIKKN 365

  Fly   376 LTPRPARRQIGGSLSNESRARSCSSLDNIVSSTESVRNGNGTVNQGFNNYLTVHPNLPIIRTECA 440
            .|..|.......:|     ||....|..|..|.                  |:.|.         
Human   366 NTYAPTATSYTPNL-----ARGDPGLATIAKSA------------------TIEPK--------- 398

  Fly   441 EADTVSICSARTNNDHIVDVDKDKKDTPP--TFTTMTPQEIAMWIDRRSRFLFPAMFLAFNALYW 503
                              :|..:.|...|  ||.:::.      |||.||..||.:|..||.:||
Human   399 ------------------EVKPETKPPEPKKTFNSVSK------IDRLSRIAFPLLFGIFNLVYW 439

  Fly   504  503
            Human   440  439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SecClNP_001261986.1 LIC 43..505 CDD:273305 126/478 (26%)
Neur_chan_LBD 44..267 CDD:280998 54/228 (24%)
Neur_chan_memb 275..503 CDD:280999 68/238 (29%)
GABRA1NP_000797.2 LIC 14..442 CDD:273305 136/512 (27%)
LGIC_ECD_GABAAR_A1 56..249 CDD:349835 48/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.