DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QIL1 and CG43328

DIOPT Version :9

Sequence 1:NP_648983.1 Gene:QIL1 / 39948 FlyBaseID:FBgn0036726 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001286516.1 Gene:CG43328 / 246625 FlyBaseID:FBgn0263033 Length:241 Species:Drosophila melanogaster


Alignment Length:113 Identity:32/113 - (28%)
Similarity:57/113 - (50%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLGFLVRGGLVAATVYYTQKVGIWGDSDQTDKLYNDIKSELRPHVQKLEKQLPFEVPQLPKTGE 65
            ||:|.::|.|:|.|.|..|:..|:|...::|..:|::....:.|:..:..::|....|:.|..||
  Fly     1 MVVGLILRAGVVYAVVMVTKNYGVWESPNKTQDVYDETVERIEPYADQARRKLNICPPRPPPEGE 65

  Fly    66 MRFLAKHYYNEGVKNTFRFIHMLPCYAGRGLKKV-------KDTFQDF 106
            ..|...:|||:.||:.|..:.:.|......|:||       .:|.|.:
  Fly    66 WSFFGIYYYNKLVKSVFDLLSVFPAGLAAFLEKVPSYVNAFNETIQKY 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QIL1NP_648983.1 QIL1 3..97 CDD:292509 25/93 (27%)
CG43328NP_001286516.1 QIL1 3..97 CDD:292509 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31816
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.