DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment QIL1 and CG43327

DIOPT Version :10

Sequence 1:NP_648983.1 Gene:QIL1 / 39948 FlyBaseID:FBgn0036726 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001246382.1 Gene:CG43327 / 12798323 FlyBaseID:FBgn0263032 Length:149 Species:Drosophila melanogaster


Alignment Length:36 Identity:9/36 - (25%)
Similarity:14/36 - (38%) Gaps:11/36 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YYTQKVGIWG-----------DSDQTDKLYNDIKSE 41
            :.|||:...|           :..:..|.|.|.:||
  Fly    63 HQTQKILSHGFDCPRRSFKSSNDSEISKFYGDYRSE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QIL1NP_648983.1 QIL1 19..95 CDD:464923 9/34 (26%)
CG43327NP_001246382.1 None

Return to query results.
Submit another query.