DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12229 and PKM

DIOPT Version :9

Sequence 1:NP_648980.1 Gene:CG12229 / 39945 FlyBaseID:FBgn0036723 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_001193725.1 Gene:PKM / 5315 HGNCID:9021 Length:605 Species:Homo sapiens


Alignment Length:477 Identity:104/477 - (21%)
Similarity:187/477 - (39%) Gaps:72/477 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RRMLENGTYTFHVDTVGNKPDELKAILDTMNIAISAHSAERELRLTTGLALEINGECCRVGRLRN 155
            |....:||:.:|.:|:.|           :..|..:.:::..|.....:||:..|...|.|.::.
Human   147 RLNFSHGTHEYHAETIKN-----------VRTATESFASDPILYRPVAVALDTKGPEIRTGLIKG 200

  Fly   156 NCT--VMLARGGVVTLTTDESYRYKGFKEIVYVINLRCYLASVQLG-----DIVMIGREVRGKVV 213
            :.|  |.|.:|..:.:|.|.:|..|..:.|:: ::.:.....|::|     |..:|..:|:.|..
Human   201 SGTAEVELKKGATLKITLDNAYMEKCDENILW-LDYKNICKVVEVGSKIYVDDGLISLQVKQKGA 264

  Fly   214 KTLREALTVMIIDAGLVASYDFIELPRQCHALDPDLYPDLYMKDLEMAASLNANYVVLPKIRCKS 278
                :.|...:.:.|.:.|...:.||..  |:|.....:..::||:.....:.:.|....||..|
Human   265 ----DFLVTEVENGGSLGSKKGVNLPGA--AVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAS 323

  Fly   279 FLRAVRQTL-NSDFNLKLIGMID-FEYVRSNMLDLLGIIKLVDYIWIP--DMFNVNCCVYNYIME 339
            .:..||:.| ....|:|:|..|: .|.||  ..|  .|::..|.|.:.  |: .:........:.
Human   324 DVHEVRKVLGEKGKNIKIISKIENHEGVR--RFD--EILEASDGIMVARGDL-GIEIPAEKVFLA 383

  Fly   340 DVLPISQCQK--KPVI-GTVPLERCSDFK-----RFELHD----FLWKVDAIHIQKSPWCNKYPL 392
            ..:.|.:|.:  |||| .|..||  |..|     |.|..|    .|...|.|.:........|||
Human   384 QKMMIGRCNRAGKPVICATQMLE--SMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPL 446

  Fly   393 IVKKLMPI--KDYRVGAVQNKMVLKSILTSYQTIVNFIIRTISSIE----CQAIFLFTTCETASV 451
            ...::..:  ::........|:..:.:..|..:........:.|:|    |.|..|....|:...
Human   447 EAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRS 511

  Fly   452 A--LSRIEIYCPVYVMVPLEETDDAETITCKVELARALHLRRNMHPVLYTKDLNECSYSPIEFGV 514
            |  ::|.....|:.            .:|...:.||..||.|.:.|||....:.|.....::..|
Human   512 AHQVARYRPRAPII------------AVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV 564

  Fly   515 DFM----RKKGCLEVGDFVVTL 532
            :|.    :.:|..:.||.|:.|
Human   565 NFAMNVGKARGFFKKGDVVIVL 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12229NP_648980.1 pyruv_kin 103..530 CDD:273424 98/461 (21%)
Pyruvate_Kinase 126..530 CDD:304951 95/438 (22%)
PKMNP_001193725.1 Pyruvate_Kinase 116..604 CDD:238178 104/477 (22%)
pyruv_kin 117..601 CDD:273424 104/477 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.