DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32176 and CAAP1

DIOPT Version :9

Sequence 1:NP_730271.1 Gene:CG32176 / 39944 FlyBaseID:FBgn0052176 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_079104.3 Gene:CAAP1 / 79886 HGNCID:25834 Length:361 Species:Homo sapiens


Alignment Length:240 Identity:58/240 - (24%)
Similarity:100/240 - (41%) Gaps:67/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LHPMSHYIDDRLELVKQIFGTLKPKTILNLAPEFLKKTPLDEIEELCLEELLCLSTKRLKSIIEN 96
            |.|:|.||.|:.|:::|.|..:..|.:..:.|:.||...::||::||.|:|..||.|::..|:|.
Human   133 LKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSIEEIKKLCQEQLELLSEKKILKILEG 197

  Fly    97 TKCPTDTESSEDSDVEHKEEH--------ISLEEISSDSDIGGQESRKTKKKLRSKKTNNGNENK 153
                   ::..|||:|.:.:.        :|.::|..||          ...:|..|...|.|.|
Human   198 -------DNGMDSDMEEEADDGSKMGSDLVSQQDICIDS----------ASSVRENKQPEGLELK 245

  Fly   154 ESGGQMSVLELLELQARARAIRSQLAMEPITKIEVKSDDDID----------EVPVEKVQRK--- 205
            :..|:.|  ::|.:.|.|                  .|.||:          |.|...||.:   
Human   246 QGKGEDS--DVLSINADA------------------YDSDIEGPCNEEAAAPEAPENTVQSEAGQ 290

  Fly   206 ----EKD-KRSTKK----TDSSKRKSQESARPTSPSQPDSSSKEQ 241
                ||| ::|..:    .:||..:.:.:.....|.:....|.:|
Human   291 IDDLEKDIEKSVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32176NP_730271.1 CAAP1 33..94 CDD:291980 21/60 (35%)
SPATA3 199..>296 CDD:292290 11/55 (20%)
CAAP1NP_079104.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..100
CAAP1 134..195 CDD:291980 21/60 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..218 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..331 24/120 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145602
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29F4A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14740
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.