DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32176 and Caap1

DIOPT Version :9

Sequence 1:NP_730271.1 Gene:CG32176 / 39944 FlyBaseID:FBgn0052176 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_080644.2 Gene:Caap1 / 67770 MGIID:1915020 Length:356 Species:Mus musculus


Alignment Length:265 Identity:62/265 - (23%)
Similarity:110/265 - (41%) Gaps:66/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SIKKEKIEEER------------KLHPMSHYIDDRLELVKQIFGTLKPKTILNLAPEFLKKTPLD 72
            |::||....|.            .|.|:|.||.|:.|:::|.|..:..|.:..:.|:.||...::
Mouse    89 SLEKELFLAEHSDLEEGGLDLNVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSVE 153

  Fly    73 EIEELCLEELLCLSTKRLKSIIENTKCPTDTESSEDSDVEHKEEH--------ISLEEISSDSDI 129
            ||::||.|:|..||.|::..|:|.       ::..|||:|.:.:.        ||.::...||  
Mouse   154 EIKKLCQEQLELLSEKQILKILEG-------DNGLDSDMEEEADDGCKVAPDLISQQDTCVDS-- 209

  Fly   130 GGQESRKTKKKLRSKKTNNGNENKESGGQMSVLELLELQARA-----------RAIRSQLAMEPI 183
                    ...||..|.....|:|:..|:.|  ::|.:.|.|           .|..:..|....
Mouse   210 --------TSSLRENKQPEVLESKQGKGEDS--DVLSINADAYDSDIEGPSIDEAAAAATATPAA 264

  Fly   184 TKIEVKSDDDIDEVPVEKVQRK-------EKD-KRSTKK----TDSSKRKSQESARPTSPSQPDS 236
            |.:...:    .|||...||.:       |:| ::|..:    .:||.::.:.:.....|::...
Mouse   265 TAVATAA----SEVPENTVQSEAGQIDDLERDIEKSVNEILGLAESSPKEPKVATLTVPPAEDVQ 325

  Fly   237 SSKEQ 241
            .|.:|
Mouse   326 PSAQQ 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32176NP_730271.1 CAAP1 33..94 CDD:291980 21/60 (35%)
SPATA3 199..>296 CDD:292290 10/55 (18%)
Caap1NP_080644.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..80
CAAP1 114..175 CDD:291980 21/60 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..234 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835668
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29F4A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14740
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.