DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32176 and caap1

DIOPT Version :9

Sequence 1:NP_730271.1 Gene:CG32176 / 39944 FlyBaseID:FBgn0052176 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001313632.1 Gene:caap1 / 100329847 -ID:- Length:293 Species:Danio rerio


Alignment Length:260 Identity:59/260 - (22%)
Similarity:97/260 - (37%) Gaps:92/260 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKAKKSS-------------KGDQIPKPISIKKEKIEEERKLHPMSHYIDDRLELVKQIFGTLKP 55
            :|.:||.             :|.|  :|..::...::..|...|:|.|:.:|.|:::|.|..|..
Zfish    25 MKRRKSGPSMEECRQPLEPPEGPQ--EPSELEDGGLDLSRSFKPISGYMQERREMLEQCFSVLGE 87

  Fly    56 KTILNLAPEFLKKTPLDEIEELCLEELLCLSTKRLKSII-----------ENTKCPTDTESSEDS 109
            ..:..:.|:.||...|:||::||.::||.:|...|..|:           |...|   |:|.:||
Zfish    88 NKLQEMLPDGLKDCSLNEIKKLCWDQLLQISDIHLLEILDGKELSVLAAPEQKSC---TDSQQDS 149

  Fly   110 ------------DVEHKE------EHISLEEISSDSDIGGQESRKTK------------------ 138
                        |.|.|:      :.:|:.....||||.|.:..|::                  
Zfish   150 NVDSTSSLRDNPDTEEKQGSGEDSDVLSINAEIDDSDIEGHKVPKSEEPSLKDEAPPPKDEAPPP 214

  Fly   139 ---------------------------KKLRSKKTNNGNENKESGGQMSVLELLELQARARAIRS 176
                                       :|..|.:.....|..|.......||||||:.|||||::
Zfish   215 AQPPEPKVELQQDIERSVSEILSCSESRKEPSAERAGAPETAEKHPSAQQLELLELEMRARAIKA 279

  Fly   177  176
            Zfish   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32176NP_730271.1 CAAP1 33..94 CDD:291980 20/60 (33%)
SPATA3 199..>296 CDD:292290
caap1NP_001313632.1 CAAP1 65..126 CDD:291980 20/60 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29F4A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14740
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.